Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | HipBST/HipA(toxin) |
Location | 2608817..2610060 | Replicon | chromosome |
Accession | NZ_CP113436 | ||
Organism | Legionella pneumophila strain PATHC021 |
Toxin (Protein)
Gene name | HipT | Uniprot ID | Q5ZSZ6 |
Locus tag | OXA88_RS11545 | Protein ID | WP_010948074.1 |
Coordinates | 2609122..2610060 (+) | Length | 313 a.a. |
Antitoxin (Protein)
Gene name | HipS | Uniprot ID | Q5ZSZ7 |
Locus tag | OXA88_RS11540 | Protein ID | WP_010948073.1 |
Coordinates | 2608817..2609125 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXA88_RS11510 (OXA88_11510) | 2604253..2604618 | + | 366 | WP_010948069.1 | BRCT domain-containing protein | - |
OXA88_RS11515 (OXA88_11515) | 2604975..2605340 | - | 366 | WP_010948070.1 | TraK family protein | - |
OXA88_RS11520 (OXA88_11520) | 2605525..2605665 | - | 141 | WP_153802426.1 | hypothetical protein | - |
OXA88_RS11525 (OXA88_11525) | 2605668..2607419 | - | 1752 | WP_010948071.1 | DUF927 domain-containing protein | - |
OXA88_RS11530 (OXA88_11530) | 2607485..2607760 | - | 276 | WP_010948072.1 | helix-turn-helix domain-containing protein | - |
OXA88_RS11535 (OXA88_11535) | 2608593..2608820 | + | 228 | WP_006870829.1 | helix-turn-helix transcriptional regulator | - |
OXA88_RS11540 (OXA88_11540) | 2608817..2609125 | + | 309 | WP_010948073.1 | HipA N-terminal domain-containing protein | Antitoxin |
OXA88_RS11545 (OXA88_11545) | 2609122..2610060 | + | 939 | WP_010948074.1 | lpg2370 family Dot/Icm T4SS effector | Toxin |
OXA88_RS11550 (OXA88_11550) | 2610603..2611217 | + | 615 | WP_010948075.1 | hypothetical protein | - |
OXA88_RS11555 (OXA88_11555) | 2611373..2611579 | - | 207 | WP_015444115.1 | hypothetical protein | - |
OXA88_RS11560 (OXA88_11560) | 2611916..2613184 | + | 1269 | WP_010948076.1 | lpg2372 family Dot/Icm T4SS effector | - |
OXA88_RS11565 (OXA88_11565) | 2613654..2613944 | - | 291 | WP_223804318.1 | hypothetical protein | - |
OXA88_RS11570 (OXA88_11570) | 2613925..2614590 | - | 666 | WP_015444114.1 | hypothetical protein | - |
OXA88_RS11575 (OXA88_11575) | 2614766..2614897 | - | 132 | WP_015444112.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2602839..2604014 | 1175 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 313 a.a. Molecular weight: 36077.81 Da Isoelectric Point: 8.6882
>T265716 WP_010948074.1 NZ_CP113436:2609122-2610060 [Legionella pneumophila]
MKHCPITYEKISDQENYSQRGLHLLSPQLKNLSPLDLSADEQRQEAIARVGKMSVQGVQKKLSAKLKIKEGCFEIVDQYG
QYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKS
SMEKVIAVIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITKDRKISISPAYDLLNSTIAQKNTKEELALPLKG
KKNNLTKSDFLKYFAIEKLGLNQNVIDGIVQEFHQVIPKWQELIGFSFLSQEMQEKYLELLEQRCKRLNFFD
MKHCPITYEKISDQENYSQRGLHLLSPQLKNLSPLDLSADEQRQEAIARVGKMSVQGVQKKLSAKLKIKEGCFEIVDQYG
QYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKS
SMEKVIAVIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITKDRKISISPAYDLLNSTIAQKNTKEELALPLKG
KKNNLTKSDFLKYFAIEKLGLNQNVIDGIVQEFHQVIPKWQELIGFSFLSQEMQEKYLELLEQRCKRLNFFD
Download Length: 939 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|