Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | HipBST/HipA(toxin) |
Location | 2676836..2678079 | Replicon | chromosome |
Accession | NZ_CP113433 | ||
Organism | Legionella pneumophila strain PATHC034 |
Toxin (Protein)
Gene name | HipT | Uniprot ID | Q5ZSZ6 |
Locus tag | OXA92_RS11955 | Protein ID | WP_010948074.1 |
Coordinates | 2677141..2678079 (+) | Length | 313 a.a. |
Antitoxin (Protein)
Gene name | HipS | Uniprot ID | Q5ZSZ7 |
Locus tag | OXA92_RS11950 | Protein ID | WP_010948073.1 |
Coordinates | 2676836..2677144 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXA92_RS11920 (OXA92_11920) | 2672272..2672637 | + | 366 | WP_010948069.1 | BRCT domain-containing protein | - |
OXA92_RS11925 (OXA92_11925) | 2672994..2673359 | - | 366 | WP_010948070.1 | TraK family protein | - |
OXA92_RS11930 (OXA92_11930) | 2673544..2673684 | - | 141 | WP_153802426.1 | hypothetical protein | - |
OXA92_RS11935 (OXA92_11935) | 2673687..2675438 | - | 1752 | WP_010948071.1 | DUF927 domain-containing protein | - |
OXA92_RS11940 (OXA92_11940) | 2675504..2675779 | - | 276 | WP_010948072.1 | helix-turn-helix domain-containing protein | - |
OXA92_RS11945 (OXA92_11945) | 2676612..2676839 | + | 228 | WP_006870829.1 | helix-turn-helix transcriptional regulator | - |
OXA92_RS11950 (OXA92_11950) | 2676836..2677144 | + | 309 | WP_010948073.1 | HipA N-terminal domain-containing protein | Antitoxin |
OXA92_RS11955 (OXA92_11955) | 2677141..2678079 | + | 939 | WP_010948074.1 | lpg2370 family Dot/Icm T4SS effector | Toxin |
OXA92_RS11960 (OXA92_11960) | 2678622..2679236 | + | 615 | WP_010948075.1 | hypothetical protein | - |
OXA92_RS11965 (OXA92_11965) | 2679392..2679598 | - | 207 | WP_015444115.1 | hypothetical protein | - |
OXA92_RS11970 (OXA92_11970) | 2679935..2681203 | + | 1269 | WP_010948076.1 | lpg2372 family Dot/Icm T4SS effector | - |
OXA92_RS11975 (OXA92_11975) | 2681673..2681963 | - | 291 | WP_223804318.1 | hypothetical protein | - |
OXA92_RS11980 (OXA92_11980) | 2681944..2682609 | - | 666 | WP_015444114.1 | hypothetical protein | - |
OXA92_RS11985 (OXA92_11985) | 2682785..2682916 | - | 132 | WP_015444112.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2670858..2672033 | 1175 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 313 a.a. Molecular weight: 36077.81 Da Isoelectric Point: 8.6882
>T265712 WP_010948074.1 NZ_CP113433:2677141-2678079 [Legionella pneumophila]
MKHCPITYEKISDQENYSQRGLHLLSPQLKNLSPLDLSADEQRQEAIARVGKMSVQGVQKKLSAKLKIKEGCFEIVDQYG
QYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKS
SMEKVIAVIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITKDRKISISPAYDLLNSTIAQKNTKEELALPLKG
KKNNLTKSDFLKYFAIEKLGLNQNVIDGIVQEFHQVIPKWQELIGFSFLSQEMQEKYLELLEQRCKRLNFFD
MKHCPITYEKISDQENYSQRGLHLLSPQLKNLSPLDLSADEQRQEAIARVGKMSVQGVQKKLSAKLKIKEGCFEIVDQYG
QYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKS
SMEKVIAVIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITKDRKISISPAYDLLNSTIAQKNTKEELALPLKG
KKNNLTKSDFLKYFAIEKLGLNQNVIDGIVQEFHQVIPKWQELIGFSFLSQEMQEKYLELLEQRCKRLNFFD
Download Length: 939 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|