Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5133842..5134436 | Replicon | chromosome |
| Accession | NZ_CP113432 | ||
| Organism | Pseudomonas sp. ZM23 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | OU419_RS23765 | Protein ID | WP_192400966.1 |
| Coordinates | 5134158..5134436 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OU419_RS23760 | Protein ID | WP_254476610.1 |
| Coordinates | 5133842..5134147 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OU419_RS23745 (OU419_23745) | 5130055..5130918 | - | 864 | WP_254476612.1 | integrase domain-containing protein | - |
| OU419_RS23750 (OU419_23750) | 5131521..5132678 | - | 1158 | WP_254476611.1 | STY4528 family pathogenicity island replication protein | - |
| OU419_RS23760 (OU419_23760) | 5133842..5134147 | - | 306 | WP_254476610.1 | HigA family addiction module antitoxin | Antitoxin |
| OU419_RS23765 (OU419_23765) | 5134158..5134436 | - | 279 | WP_192400966.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OU419_RS23770 (OU419_23770) | 5134489..5135481 | - | 993 | WP_254476609.1 | tyrosine-type recombinase/integrase | - |
| OU419_RS23775 (OU419_23775) | 5135478..5136770 | - | 1293 | WP_254476608.1 | hypothetical protein | - |
| OU419_RS23780 (OU419_23780) | 5137010..5138299 | - | 1290 | WP_268172348.1 | zonular occludens toxin domain-containing protein | - |
| OU419_RS23785 (OU419_23785) | 5138303..5138659 | - | 357 | WP_254476845.1 | DUF2523 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 5117526..5146021 | 28495 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10618.10 Da Isoelectric Point: 7.2453
>T265711 WP_192400966.1 NZ_CP113432:c5134436-5134158 [Pseudomonas sp. ZM23]
MILTFRCDETRQLFESGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGNRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFESGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGNRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|