Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4558492..4559246 | Replicon | chromosome |
| Accession | NZ_CP113364 | ||
| Organism | Salmonella enterica subsp. enterica strain KNP01 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | OU685_RS22105 | Protein ID | WP_000558166.1 |
| Coordinates | 4558492..4558803 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OU685_RS22110 | Protein ID | WP_001259011.1 |
| Coordinates | 4558800..4559246 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OU685_RS22075 (4554150) | 4554150..4555052 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| OU685_RS22080 (4555049) | 4555049..4555684 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OU685_RS22085 (4555681) | 4555681..4556610 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| OU685_RS22090 (4556657) | 4556657..4556947 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| OU685_RS22095 (4556948) | 4556948..4557259 | - | 312 | WP_001159628.1 | hypothetical protein | - |
| OU685_RS22100 (4557477) | 4557477..4558406 | + | 930 | WP_017441897.1 | alpha/beta hydrolase | - |
| OU685_RS22105 (4558492) | 4558492..4558803 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OU685_RS22110 (4558800) | 4558800..4559246 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| OU685_RS22115 (4559261) | 4559261..4560202 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| OU685_RS22120 (4560247) | 4560247..4560684 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| OU685_RS22125 (4560681) | 4560681..4561553 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| OU685_RS22130 (4561547) | 4561547..4562146 | - | 600 | WP_000965702.1 | glucose-1-phosphatase | - |
| OU685_RS22135 (4562337) | 4562337..4563140 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| OU685_RS22140 (4563174) | 4563174..4564070 | - | 897 | WP_017441898.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T265701 WP_000558166.1 NZ_CP113364:4558492-4558803 [Salmonella enterica subsp. enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT265701 WP_001259011.1 NZ_CP113364:4558800-4559246 [Salmonella enterica subsp. enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|