Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2026451..2027178 | Replicon | chromosome |
| Accession | NZ_CP113364 | ||
| Organism | Salmonella enterica subsp. enterica strain KNP01 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A418Z4H3 |
| Locus tag | OU685_RS09955 | Protein ID | WP_017441960.1 |
| Coordinates | 2026867..2027178 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OU685_RS09950 | Protein ID | WP_000561389.1 |
| Coordinates | 2026451..2026870 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OU685_RS09920 (2023271) | 2023271..2023799 | + | 529 | Protein_1937 | transposase | - |
| OU685_RS09925 (2023945) | 2023945..2024085 | - | 141 | WP_031615664.1 | hypothetical protein | - |
| OU685_RS09930 (2024251) | 2024251..2024520 | - | 270 | WP_077907250.1 | hypothetical protein | - |
| OU685_RS09935 (2024891) | 2024891..2025310 | + | 420 | WP_017441959.1 | GNAT family N-acetyltransferase | - |
| OU685_RS09940 (2025546) | 2025546..2025704 | - | 159 | WP_023165344.1 | lipopolysaccharide 1,2-N-acetylglucosaminetransferase | - |
| OU685_RS09945 (2025701) | 2025701..2026195 | - | 495 | WP_077907251.1 | glycosyltransferase | - |
| OU685_RS09950 (2026451) | 2026451..2026870 | - | 420 | WP_000561389.1 | helix-turn-helix domain-containing protein | Antitoxin |
| OU685_RS09955 (2026867) | 2026867..2027178 | - | 312 | WP_017441960.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OU685_RS09960 (2027357) | 2027357..2027656 | + | 300 | WP_017441961.1 | hypothetical protein | - |
| OU685_RS09965 (2027955) | 2027955..2028737 | - | 783 | WP_023242818.1 | DUF2971 domain-containing protein | - |
| OU685_RS09970 (2029100) | 2029100..2029252 | - | 153 | WP_153257556.1 | hypothetical protein | - |
| OU685_RS09975 (2029404) | 2029404..2029880 | - | 477 | WP_017441964.1 | hypothetical protein | - |
| OU685_RS09980 (2030208) | 2030208..2030603 | - | 396 | WP_000422887.1 | DUF1398 domain-containing protein | - |
| OU685_RS09985 (2031284) | 2031284..2032006 | + | 723 | WP_017441965.1 | SPI-1 type III secretion system guanine nucleotide exchange factor SopE2 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2023461..2023799 | 338 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12453.27 Da Isoelectric Point: 10.1599
>T265688 WP_017441960.1 NZ_CP113364:c2027178-2026867 [Salmonella enterica subsp. enterica]
MHVISKEPFDEAARRYPNDSLAIKALYRLVRERDFSSPAELRKVIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFINKRF
YVKHIATHAEYDKLTRYYRENKE
MHVISKEPFDEAARRYPNDSLAIKALYRLVRERDFSSPAELRKVIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFINKRF
YVKHIATHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15301.49 Da Isoelectric Point: 4.6286
>AT265688 WP_000561389.1 NZ_CP113364:c2026870-2026451 [Salmonella enterica subsp. enterica]
MIANTAKAIEATKALVAAVPFLGGSASEKDYRDALALVDYLIENDDENPLIDFLASKIAEYEDNSKQFAEFNKSVAEMPV
GVALLRTLIDQYKLSYSDLKEEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MIANTAKAIEATKALVAAVPFLGGSASEKDYRDALALVDYLIENDDENPLIDFLASKIAEYEDNSKQFAEFNKSVAEMPV
GVALLRTLIDQYKLSYSDLKEEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|