Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 242907..243541 | Replicon | chromosome |
| Accession | NZ_CP113343 | ||
| Organism | Arthrobacter sp. MMS18-M83 | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | - |
| Locus tag | OW521_RS01135 | Protein ID | WP_268022210.1 |
| Coordinates | 243212..243541 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | HigA2 | Uniprot ID | - |
| Locus tag | OW521_RS01130 | Protein ID | WP_268022208.1 |
| Coordinates | 242907..243212 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OW521_RS01105 (OW521_01105) | 238461..240062 | + | 1602 | WP_268022201.1 | TIGR04141 family sporadically distributed protein | - |
| OW521_RS01110 (OW521_01110) | 240334..240741 | - | 408 | WP_268022203.1 | GNAT family N-acetyltransferase | - |
| OW521_RS01115 (OW521_01115) | 240794..241003 | - | 210 | WP_268026132.1 | hypothetical protein | - |
| OW521_RS01120 (OW521_01120) | 241016..241219 | - | 204 | Protein_223 | LysR family transcriptional regulator | - |
| OW521_RS01125 (OW521_01125) | 241445..241978 | - | 534 | WP_268022206.1 | HIRAN domain-containing protein | - |
| OW521_RS01130 (OW521_01130) | 242907..243212 | - | 306 | WP_268022208.1 | XRE family transcriptional regulator | Antitoxin |
| OW521_RS01135 (OW521_01135) | 243212..243541 | - | 330 | WP_268022210.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OW521_RS01140 (OW521_01140) | 243633..243833 | - | 201 | WP_268022212.1 | hypothetical protein | - |
| OW521_RS01145 (OW521_01145) | 243970..244098 | - | 129 | WP_268022214.1 | hypothetical protein | - |
| OW521_RS01150 (OW521_01150) | 244485..245891 | - | 1407 | WP_268022216.1 | tetratricopeptide repeat protein | - |
| OW521_RS01155 (OW521_01155) | 245893..247170 | - | 1278 | WP_268022218.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12307.03 Da Isoelectric Point: 6.7278
>T265677 WP_268022210.1 NZ_CP113343:c243541-243212 [Arthrobacter sp. MMS18-M83]
VESWLLGLDQDSYEQVIAALELLAERGPQLGRPLVDTVVRSRHRNMKELRPGSSGRSELRILFAFDPERHAILLVAGDKA
GNWSKWYKTNIPIADDLFDDHLRILKGGS
VESWLLGLDQDSYEQVIAALELLAERGPQLGRPLVDTVVRSRHRNMKELRPGSSGRSELRILFAFDPERHAILLVAGDKA
GNWSKWYKTNIPIADDLFDDHLRILKGGS
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|