Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2498134..2498318 | Replicon | chromosome |
| Accession | NZ_CP113231 | ||
| Organism | Staphylococcus aureus strain BIAI 158 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | OSZ57_RS12420 | Protein ID | WP_000482647.1 |
| Coordinates | 2498134..2498241 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2498258..2498318 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSZ57_RS12395 | 2493498..2493971 | + | 474 | WP_000456491.1 | GyrI-like domain-containing protein | - |
| OSZ57_RS12400 | 2494094..2495305 | - | 1212 | WP_001191975.1 | multidrug effflux MFS transporter | - |
| OSZ57_RS12405 | 2495485..2496144 | - | 660 | WP_000831298.1 | membrane protein | - |
| OSZ57_RS12410 | 2496204..2497346 | - | 1143 | WP_001176860.1 | glycerate kinase | - |
| OSZ57_RS12415 | 2497614..2498000 | + | 387 | WP_000779354.1 | flippase GtxA | - |
| OSZ57_RS12420 | 2498134..2498241 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 2498258..2498318 | - | 61 | - | - | Antitoxin |
| OSZ57_RS12425 | 2498268..2498435 | + | 168 | WP_000301894.1 | hypothetical protein | - |
| OSZ57_RS12430 | 2498813..2500552 | + | 1740 | WP_001064831.1 | ABC transporter ATP-binding protein | - |
| OSZ57_RS12435 | 2500601..2502334 | + | 1734 | WP_000488492.1 | ABC transporter ATP-binding protein | - |
| OSZ57_RS12440 | 2502565..2502732 | + | 168 | WP_031785511.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T265642 WP_000482647.1 NZ_CP113231:2498134-2498241 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT265642 NZ_CP113231:c2498318-2498258 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|