Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 1601002..1601309 | Replicon | chromosome |
| Accession | NZ_CP113231 | ||
| Organism | Staphylococcus aureus strain BIAI 158 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | OSZ57_RS08055 | Protein ID | WP_011447039.1 |
| Coordinates | 1601133..1601309 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 1601002..1601141 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSZ57_RS08015 (1596342) | 1596342..1596602 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| OSZ57_RS08020 (1596655) | 1596655..1597005 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| OSZ57_RS08025 (1597689) | 1597689..1598138 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| OSZ57_RS08030 (1598233) | 1598233..1598568 | - | 336 | Protein_1542 | SH3 domain-containing protein | - |
| OSZ57_RS08035 (1599218) | 1599218..1599709 | - | 492 | WP_000919350.1 | staphylokinase | - |
| OSZ57_RS08040 (1599900) | 1599900..1600655 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| OSZ57_RS08045 (1600667) | 1600667..1600921 | - | 255 | WP_000611512.1 | phage holin | - |
| OSZ57_RS08050 (1600973) | 1600973..1601080 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - (1601002) | 1601002..1601141 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1601002) | 1601002..1601141 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1601002) | 1601002..1601141 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1601002) | 1601002..1601141 | + | 140 | NuclAT_0 | - | Antitoxin |
| OSZ57_RS08055 (1601133) | 1601133..1601309 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| OSZ57_RS08060 (1601459) | 1601459..1601755 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| OSZ57_RS08065 (1601813) | 1601813..1602100 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| OSZ57_RS08070 (1602147) | 1602147..1602299 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| OSZ57_RS08075 (1602289) | 1602289..1606074 | - | 3786 | WP_000582165.1 | phage tail spike protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL | 1596655..1646994 | 50339 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T265640 WP_011447039.1 NZ_CP113231:c1601309-1601133 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT265640 NZ_CP113231:1601002-1601141 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
