Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 2797160..2797755 | Replicon | chromosome |
| Accession | NZ_CP113230 | ||
| Organism | Pseudomonas aeruginosa strain BIAI 160 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | OSZ60_RS13320 | Protein ID | WP_003113526.1 |
| Coordinates | 2797160..2797438 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OSZ60_RS13325 | Protein ID | WP_003099268.1 |
| Coordinates | 2797450..2797755 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSZ60_RS13300 (OSZ60_13300) | 2792586..2793824 | + | 1239 | WP_033938786.1 | C69 family dipeptidase | - |
| OSZ60_RS13305 (OSZ60_13305) | 2793886..2794533 | + | 648 | WP_003095021.1 | carbonate dehydratase | - |
| OSZ60_RS13310 (OSZ60_13310) | 2794603..2796831 | - | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
| OSZ60_RS13315 (OSZ60_13315) | 2796979..2797107 | + | 129 | Protein_2630 | integrase | - |
| OSZ60_RS13320 (OSZ60_13320) | 2797160..2797438 | + | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OSZ60_RS13325 (OSZ60_13325) | 2797450..2797755 | + | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
| OSZ60_RS13335 (OSZ60_13335) | 2798152..2799252 | - | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| OSZ60_RS13340 (OSZ60_13340) | 2799293..2799877 | - | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| OSZ60_RS13345 (OSZ60_13345) | 2799919..2800533 | - | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| OSZ60_RS13350 (OSZ60_13350) | 2800650..2801591 | - | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| OSZ60_RS13360 (OSZ60_13360) | 2801758..2802606 | - | 849 | WP_003117426.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T265630 WP_003113526.1 NZ_CP113230:2797160-2797438 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|