Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2704323..2704999 | Replicon | chromosome |
Accession | NZ_CP113229 | ||
Organism | Streptomyces albidoflavus strain J1074_D14 4N24 |
Toxin (Protein)
Gene name | HigB2 | Uniprot ID | D6AZC1 |
Locus tag | SAD14N_RS11995 | Protein ID | WP_003949888.1 |
Coordinates | 2704637..2704999 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | SAD14N_RS11990 | Protein ID | WP_015507386.1 |
Coordinates | 2704323..2704640 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAD14N_RS11965 (SAD14N_2454) | 2699609..2700670 | + | 1062 | WP_008404846.1 | hypothetical protein | - |
SAD14N_RS11970 (SAD14N_2455) | 2700886..2701416 | + | 531 | WP_003949893.1 | toxin-antitoxin system HicB family antitoxin | - |
SAD14N_RS11975 (SAD14N_2456) | 2701518..2702387 | + | 870 | WP_003949892.1 | DUF4097 family beta strand repeat-containing protein | - |
SAD14N_RS11980 (SAD14N_2457) | 2702491..2703465 | + | 975 | WP_003949891.1 | daunorubicin resistance protein DrrA family ABC transporter ATP-binding protein | - |
SAD14N_RS11985 (SAD14N_2458) | 2703462..2704244 | + | 783 | WP_003949890.1 | ABC transporter permease | - |
SAD14N_RS11990 (SAD14N_2459) | 2704323..2704640 | - | 318 | WP_015507386.1 | helix-turn-helix transcriptional regulator | Antitoxin |
SAD14N_RS11995 | 2704637..2704999 | - | 363 | WP_003949888.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
SAD14N_RS12000 (SAD14N_2461) | 2704998..2706695 | + | 1698 | WP_003949889.1 | hypothetical protein | - |
SAD14N_RS12005 (SAD14N_2462) | 2706785..2707027 | - | 243 | WP_015507388.1 | hypothetical protein | - |
SAD14N_RS12010 (SAD14N_2463) | 2707331..2708185 | + | 855 | WP_015507389.1 | STAS domain-containing protein | - |
SAD14N_RS12015 (SAD14N_2464) | 2708182..2708562 | + | 381 | WP_003949885.1 | STAS domain-containing protein | - |
SAD14N_RS12020 (SAD14N_2465) | 2708562..2708978 | + | 417 | WP_003949884.1 | ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13472.34 Da Isoelectric Point: 4.7680
>T265628 WP_003949888.1 NZ_CP113229:c2704999-2704637 [Streptomyces albidoflavus]
MDGEWQIFLVDEVRVWLASLDGAAHARVVQALDVLAEEGPALGRPLVDTLRGSAVANLKELRPGTVRILFAFDPWRSSIL
LVAGDKSGQRTEWYQEAIPLAEQRYALYLKEREREEGGRP
MDGEWQIFLVDEVRVWLASLDGAAHARVVQALDVLAEEGPALGRPLVDTLRGSAVANLKELRPGTVRILFAFDPWRSSIL
LVAGDKSGQRTEWYQEAIPLAEQRYALYLKEREREEGGRP
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|