Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2113287..2113586 | Replicon | chromosome |
Accession | NC_017331 | ||
Organism | Staphylococcus aureus subsp. aureus TW20 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
Locus tag | SATW20_RS16435 | Protein ID | WP_072482930.1 |
Coordinates | 2113410..2113586 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2113287..2113342 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SATW20_RS10670 | 2108845..2109024 | + | 180 | WP_000669789.1 | hypothetical protein | - |
SATW20_RS10680 | 2109335..2109595 | + | 261 | WP_001791826.1 | hypothetical protein | - |
SATW20_RS10685 | 2109648..2109998 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
SATW20_RS16825 | 2110508..2110843 | - | 336 | Protein_2030 | SH3 domain-containing protein | - |
SATW20_RS10695 | 2111495..2111986 | - | 492 | WP_000920041.1 | staphylokinase | - |
SATW20_RS10700 | 2112177..2112932 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
SATW20_RS10705 | 2112944..2113198 | - | 255 | WP_000611512.1 | phage holin | - |
SATW20_RS10710 | 2113250..2113357 | + | 108 | Protein_2034 | hypothetical protein | - |
- | 2113279..2113418 | + | 140 | NuclAT_0 | - | - |
- | 2113279..2113418 | + | 140 | NuclAT_0 | - | - |
- | 2113279..2113418 | + | 140 | NuclAT_0 | - | - |
- | 2113279..2113418 | + | 140 | NuclAT_0 | - | - |
- | 2113287..2113342 | + | 56 | - | - | Antitoxin |
SATW20_RS16435 | 2113410..2113586 | - | 177 | WP_072482930.1 | putative holin-like toxin | Toxin |
SATW20_RS10720 | 2113695..2114468 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
SATW20_RS10725 | 2114841..2115215 | - | 375 | WP_000340977.1 | hypothetical protein | - |
SATW20_RS10730 | 2115271..2115558 | - | 288 | WP_001262621.1 | hypothetical protein | - |
SATW20_RS10735 | 2115604..2115756 | - | 153 | WP_001000059.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / sea / hlb / groEL | 2109648..2167173 | 57525 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T26557 WP_072482930.1 NC_017331:c2113586-2113410 [Staphylococcus aureus subsp. aureus TW20]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
>T26557 NC_017331:c2113586-2113410 [Staphylococcus aureus subsp. aureus TW20]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT26557 NC_017331:2113287-2113342 [Staphylococcus aureus subsp. aureus TW20]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|