Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 732763..733538 | Replicon | chromosome |
Accession | NZ_CP113192 | ||
Organism | Klebsiella pneumoniae strain SXC4-2 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
Locus tag | OT483_RS03625 | Protein ID | WP_004150910.1 |
Coordinates | 733053..733538 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | OT483_RS03620 | Protein ID | WP_004150912.1 |
Coordinates | 732763..733056 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OT483_RS03600 (727977) | 727977..728579 | - | 603 | WP_002916735.1 | short chain dehydrogenase | - |
OT483_RS03605 (728677) | 728677..729588 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
OT483_RS03610 (729589) | 729589..730737 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
OT483_RS03615 (730748) | 730748..732118 | - | 1371 | WP_219716907.1 | cystathionine beta-synthase | - |
OT483_RS03620 (732763) | 732763..733056 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
OT483_RS03625 (733053) | 733053..733538 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
OT483_RS03630 (734242) | 734242..734835 | + | 594 | WP_004188553.1 | hypothetical protein | - |
OT483_RS03635 (734932) | 734932..735148 | + | 217 | Protein_713 | transposase | - |
OT483_RS03640 (735754) | 735754..736626 | + | 873 | WP_004188557.1 | ParA family protein | - |
OT483_RS03645 (736626) | 736626..737009 | + | 384 | WP_004150906.1 | hypothetical protein | - |
OT483_RS03650 (737002) | 737002..738369 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | rfaE | 670186..799232 | 129046 | |
flank | IS/Tn | - | - | 734932..735084 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T265542 WP_004150910.1 NZ_CP113192:733053-733538 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q4Q548 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |