265541

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 329069..329655 Replicon chromosome
Accession NZ_CP113192
Organism Klebsiella pneumoniae strain SXC4-2

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag OT483_RS01540 Protein ID WP_021312828.1
Coordinates 329287..329655 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag OT483_RS01535 Protein ID WP_004174006.1
Coordinates 329069..329290 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT483_RS01515 (325227) 325227..326153 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OT483_RS01520 (326150) 326150..327427 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
OT483_RS01525 (327424) 327424..328191 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OT483_RS01530 (328193) 328193..328906 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OT483_RS01535 (329069) 329069..329290 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OT483_RS01540 (329287) 329287..329655 + 369 WP_021312828.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OT483_RS01545 (329929) 329929..331245 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OT483_RS01550 (331352) 331352..332239 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OT483_RS01555 (332236) 332236..333081 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OT483_RS01560 (333083) 333083..334153 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 326150..334890 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13578.96 Da        Isoelectric Point: 8.5493

>T265541 WP_021312828.1 NZ_CP113192:329287-329655 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGYIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT265541 WP_004174006.1 NZ_CP113192:329069-329290 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References