Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 329069..329655 | Replicon | chromosome |
Accession | NZ_CP113192 | ||
Organism | Klebsiella pneumoniae strain SXC4-2 |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | OT483_RS01540 | Protein ID | WP_021312828.1 |
Coordinates | 329287..329655 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | W9B1V1 |
Locus tag | OT483_RS01535 | Protein ID | WP_004174006.1 |
Coordinates | 329069..329290 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OT483_RS01515 (325227) | 325227..326153 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
OT483_RS01520 (326150) | 326150..327427 | + | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
OT483_RS01525 (327424) | 327424..328191 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
OT483_RS01530 (328193) | 328193..328906 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
OT483_RS01535 (329069) | 329069..329290 | + | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OT483_RS01540 (329287) | 329287..329655 | + | 369 | WP_021312828.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
OT483_RS01545 (329929) | 329929..331245 | + | 1317 | WP_002920796.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
OT483_RS01550 (331352) | 331352..332239 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
OT483_RS01555 (332236) | 332236..333081 | + | 846 | WP_004145129.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
OT483_RS01560 (333083) | 333083..334153 | + | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 326150..334890 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13578.96 Da Isoelectric Point: 8.5493
>T265541 WP_021312828.1 NZ_CP113192:329287-329655 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGYIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGYIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|