265539

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4842959..4843545 Replicon chromosome
Accession NZ_CP113191
Organism Klebsiella pneumoniae strain SYCC2

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag OT482_RS26645 Protein ID WP_002920800.1
Coordinates 4842959..4843327 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag OT482_RS26650 Protein ID WP_004174006.1
Coordinates 4843324..4843545 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT482_RS26625 (4838462) 4838462..4839532 - 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
OT482_RS26630 (4839534) 4839534..4840379 - 846 WP_004181473.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OT482_RS26635 (4840376) 4840376..4841263 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OT482_RS26640 (4841370) 4841370..4842686 - 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OT482_RS26645 (4842959) 4842959..4843327 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OT482_RS26650 (4843324) 4843324..4843545 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OT482_RS26655 (4843709) 4843709..4844422 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OT482_RS26660 (4844424) 4844424..4845191 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OT482_RS26665 (4845188) 4845188..4846465 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
OT482_RS26670 (4846462) 4846462..4847388 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4837725..4858438 20713


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T265539 WP_002920800.1 NZ_CP113191:c4843327-4842959 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT265539 WP_004174006.1 NZ_CP113191:c4843545-4843324 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References