Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 1317210..1317807 | Replicon | chromosome |
Accession | NZ_CP113191 | ||
Organism | Klebsiella pneumoniae strain SYCC2 |
Toxin (Protein)
Gene name | higB | Uniprot ID | R4YIC5 |
Locus tag | OT482_RS09320 | Protein ID | WP_004142563.1 |
Coordinates | 1317210..1317527 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | OT482_RS09325 | Protein ID | WP_004142561.1 |
Coordinates | 1317520..1317807 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OT482_RS09305 (1312910) | 1312910..1314337 | - | 1428 | WP_009308097.1 | MFS transporter | - |
OT482_RS09310 (1314446) | 1314446..1315312 | + | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
OT482_RS09315 (1315982) | 1315982..1317025 | + | 1044 | WP_020325241.1 | DUF2157 domain-containing protein | - |
OT482_RS09320 (1317210) | 1317210..1317527 | + | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OT482_RS09325 (1317520) | 1317520..1317807 | + | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OT482_RS09330 (1318072) | 1318072..1318725 | - | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
OT482_RS09335 (1318845) | 1318845..1319213 | - | 369 | WP_020325252.1 | MmcQ/YjbR family DNA-binding protein | - |
OT482_RS09340 (1319213) | 1319213..1319794 | - | 582 | WP_020325240.1 | TetR/AcrR family transcriptional regulator | - |
OT482_RS09345 (1319974) | 1319974..1321089 | + | 1116 | WP_020325248.1 | MBL fold metallo-hydrolase | - |
OT482_RS09350 (1321120) | 1321120..1321461 | + | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
OT482_RS09355 (1321479) | 1321479..1321727 | - | 249 | WP_020325243.1 | DUF1158 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T265531 WP_004142563.1 NZ_CP113191:1317210-1317527 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M5MXH8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3DIQ1 |