Detailed information of TA system TA265522

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 29809..30078
• Replicon: plasmid pSYCC2_4
• Accession: NZ_CP113188
• Organism: Klebsiella pneumoniae strain SYCC2

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: OT482_RS02295
• Protein ID: WP_001372321.1
• Coordinates: 29953..30078 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	29809..29874 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OT482_RS02265	25519..26046	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
OT482_RS02270	26104..26337	+	234	WP_000006003.1	DUF905 family protein	-
OT482_RS02275	26398..28421	+	2024	Protein_35	ParB/RepB/Spo0J family partition protein	-
OT482_RS02280	28490..28924	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
OT482_RS02285	28921..29640	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	29652..29876	+	225	NuclAT_0	-	-
-	29652..29876	+	225	NuclAT_0	-	-
-	29652..29876	+	225	NuclAT_0	-	-
-	29652..29876	+	225	NuclAT_0	-	-
-	29809..29874	-	66	-	-	Antitoxin
OT482_RS02290	29862..30011	+	150	Protein_38	plasmid maintenance protein Mok	-
OT482_RS02295	29953..30078	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
OT482_RS02300	30397..30693	-	297	Protein_40	hypothetical protein	-
OT482_RS02305	30993..31289	+	297	WP_001272251.1	hypothetical protein	-
OT482_RS02310	31400..32221	+	822	WP_001234445.1	DUF932 domain-containing protein	-
OT482_RS02315	32518..33165	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
OT482_RS02320	33442..33825	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
OT482_RS02325	34016..34702	+	687	WP_015059009.1	PAS domain-containing protein	-
OT482_RS02330	34796..35023	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aph(3')-IIa / blaTEM-1B / rmtB	-	1..70383	70383

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T265522 WP_001372321.1 NZ_CP113188:29953-30078 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT265522 NZ_CP113188:c29874-29809 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin