265499

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 325017..325603 Replicon chromosome
Accession NZ_CP113178
Organism Klebsiella pneumoniae strain SYCC1

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag OT490_RS01515 Protein ID WP_094615874.1
Coordinates 325235..325603 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag OT490_RS01510 Protein ID WP_004174006.1
Coordinates 325017..325238 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT490_RS01490 (321174) 321174..322100 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OT490_RS01495 (322097) 322097..323374 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
OT490_RS01500 (323371) 323371..324138 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OT490_RS01505 (324140) 324140..324853 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OT490_RS01510 (325017) 325017..325238 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OT490_RS01515 (325235) 325235..325603 + 369 WP_094615874.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OT490_RS01520 (325876) 325876..327192 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OT490_RS01525 (327299) 327299..328186 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OT490_RS01530 (328183) 328183..329028 + 846 WP_004181473.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OT490_RS01535 (329030) 329030..330100 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 322097..330837 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13568.97 Da        Isoelectric Point: 8.6410

>T265499 WP_094615874.1 NZ_CP113178:325235-325603 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANLDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT265499 WP_004174006.1 NZ_CP113178:325017-325238 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References