Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 325017..325603 | Replicon | chromosome |
| Accession | NZ_CP113178 | ||
| Organism | Klebsiella pneumoniae strain SYCC1 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | OT490_RS01515 | Protein ID | WP_094615874.1 |
| Coordinates | 325235..325603 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | W9B1V1 |
| Locus tag | OT490_RS01510 | Protein ID | WP_004174006.1 |
| Coordinates | 325017..325238 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OT490_RS01490 (321174) | 321174..322100 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| OT490_RS01495 (322097) | 322097..323374 | + | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
| OT490_RS01500 (323371) | 323371..324138 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| OT490_RS01505 (324140) | 324140..324853 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| OT490_RS01510 (325017) | 325017..325238 | + | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OT490_RS01515 (325235) | 325235..325603 | + | 369 | WP_094615874.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| OT490_RS01520 (325876) | 325876..327192 | + | 1317 | WP_004174008.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| OT490_RS01525 (327299) | 327299..328186 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| OT490_RS01530 (328183) | 328183..329028 | + | 846 | WP_004181473.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| OT490_RS01535 (329030) | 329030..330100 | + | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 322097..330837 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13568.97 Da Isoelectric Point: 8.6410
>T265499 WP_094615874.1 NZ_CP113178:325235-325603 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANLDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANLDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|