Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 43220..43947 | Replicon | plasmid pTSYCC10-2_tmex_229k |
Accession | NZ_CP113174 | ||
Organism | Klebsiella pneumoniae strain TSYCC10-2 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A7W3D9W1 |
Locus tag | OT486_RS26305 | Protein ID | WP_011251285.1 |
Coordinates | 43220..43531 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OT486_RS26310 | Protein ID | WP_011251286.1 |
Coordinates | 43528..43947 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OT486_RS26280 (OT486_26280) | 39986..40165 | - | 180 | Protein_43 | IS5/IS1182 family transposase | - |
OT486_RS26285 (OT486_26285) | 40205..41733 | - | 1529 | Protein_44 | IS66 family transposase | - |
OT486_RS26290 (OT486_26290) | 41782..42129 | - | 348 | WP_004114612.1 | IS66 family insertion sequence element accessory protein TnpB | - |
OT486_RS26295 (OT486_26295) | 42126..42464 | - | 339 | WP_023288266.1 | transposase | - |
OT486_RS26300 (OT486_26300) | 42578..43015 | + | 438 | Protein_47 | DDE-type integrase/transposase/recombinase | - |
OT486_RS26305 (OT486_26305) | 43220..43531 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
OT486_RS26310 (OT486_26310) | 43528..43947 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
OT486_RS26315 (OT486_26315) | 44094..45062 | + | 969 | WP_077268729.1 | IS5 family transposase | - |
OT486_RS26320 (OT486_26320) | 45131..45666 | - | 536 | Protein_51 | transposase | - |
OT486_RS26325 (OT486_26325) | 46191..47558 | - | 1368 | WP_032437385.1 | formimidoylglutamate deiminase | - |
OT486_RS26330 (OT486_26330) | 47661..48422 | + | 762 | WP_017900871.1 | histidine utilization repressor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / blaDHA-1 / qnrB4 | - | 1..229076 | 229076 | |
- | inside | IScluster/Tn | - | - | 35296..45525 | 10229 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T265497 WP_011251285.1 NZ_CP113174:43220-43531 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT265497 WP_011251286.1 NZ_CP113174:43528-43947 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|