Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 642315..642901 Replicon chromosome
Accession NZ_CP113165
Organism Klebsiella pneumoniae strain TSNTC10-1

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag OT484_RS03010 Protein ID WP_002920800.1
Coordinates 642533..642901 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag OT484_RS03005 Protein ID WP_004174006.1
Coordinates 642315..642536 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT484_RS02985 (OT484_02985) 638472..639398 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OT484_RS02990 (OT484_02990) 639395..640672 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
OT484_RS02995 (OT484_02995) 640669..641436 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OT484_RS03000 (OT484_03000) 641438..642151 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OT484_RS03005 (OT484_03005) 642315..642536 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OT484_RS03010 (OT484_03010) 642533..642901 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OT484_RS03015 (OT484_03015) 643174..644490 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OT484_RS03020 (OT484_03020) 644597..645484 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OT484_RS03025 (OT484_03025) 645481..646326 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OT484_RS03030 (OT484_03030) 646328..647398 + 1071 WP_032433652.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 639395..648135 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T265446 WP_002920800.1 NZ_CP113165:642533-642901 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT265446 WP_004174006.1 NZ_CP113165:642315-642536 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References