Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3421041..3421801 | Replicon | chromosome |
| Accession | NZ_CP113163 | ||
| Organism | Citrobacter braakii strain LBA3 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | MKJ05_RS16310 | Protein ID | WP_114683723.1 |
| Coordinates | 3421041..3421352 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | MKJ05_RS16315 | Protein ID | WP_114683722.1 |
| Coordinates | 3421349..3421801 (+) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MKJ05_RS16280 (MKJ05_16280) | 3416708..3417610 | + | 903 | WP_003028691.1 | formate dehydrogenase O subunit beta | - |
| MKJ05_RS16285 (MKJ05_16285) | 3417607..3418242 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
| MKJ05_RS16290 (MKJ05_16290) | 3418239..3419168 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
| MKJ05_RS16295 (MKJ05_16295) | 3419205..3419579 | - | 375 | WP_016155182.1 | type II toxin-antitoxin system VapC family toxin | - |
| MKJ05_RS16300 (MKJ05_16300) | 3419579..3419821 | - | 243 | WP_181818053.1 | CopG family transcriptional regulator | - |
| MKJ05_RS16305 (MKJ05_16305) | 3420027..3420956 | + | 930 | WP_267583561.1 | alpha/beta hydrolase | - |
| MKJ05_RS16310 (MKJ05_16310) | 3421041..3421352 | + | 312 | WP_114683723.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| MKJ05_RS16315 (MKJ05_16315) | 3421349..3421801 | + | 453 | WP_114683722.1 | helix-turn-helix domain-containing protein | Antitoxin |
| MKJ05_RS16320 (MKJ05_16320) | 3421819..3422760 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
| MKJ05_RS16325 (MKJ05_16325) | 3422805..3423242 | - | 438 | WP_003028671.1 | D-aminoacyl-tRNA deacylase | - |
| MKJ05_RS16330 (MKJ05_16330) | 3423239..3424111 | - | 873 | WP_114683721.1 | virulence factor BrkB family protein | - |
| MKJ05_RS16335 (MKJ05_16335) | 3424105..3424704 | - | 600 | WP_114683720.1 | glucose-1-phosphatase | - |
| MKJ05_RS16340 (MKJ05_16340) | 3424809..3425612 | - | 804 | WP_016155173.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| MKJ05_RS16345 (MKJ05_16345) | 3425646..3426542 | - | 897 | WP_019077939.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12498.62 Da Isoelectric Point: 10.0209
>T265441 WP_114683723.1 NZ_CP113163:3421041-3421352 [Citrobacter braakii]
VHVISRKPFNEAILRFPNHMAALVDLLNILERKMFHTPEEMKQYIPSLDNFKYRNKWWVINVSGNCLRLIAYIDFKLQKV
FVKHIVHHAEYDRLTTYYRGHKE
VHVISRKPFNEAILRFPNHMAALVDLLNILERKMFHTPEEMKQYIPSLDNFKYRNKWWVINVSGNCLRLIAYIDFKLQKV
FVKHIVHHAEYDRLTTYYRGHKE
Download Length: 312 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16969.30 Da Isoelectric Point: 5.2636
>AT265441 WP_114683722.1 NZ_CP113163:3421349-3421801 [Citrobacter braakii]
MRTHESHQIDTASVELMIDTFTDAVKKIPLLGKEQNEAEYRKALALVEFLVDRDDLENPLFELLSARIRDYEKHAPEFSA
LNQQLEHTPHGVALLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVSHIKMLAERFNLPADAFIE
MRTHESHQIDTASVELMIDTFTDAVKKIPLLGKEQNEAEYRKALALVEFLVDRDDLENPLFELLSARIRDYEKHAPEFSA
LNQQLEHTPHGVALLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVSHIKMLAERFNLPADAFIE
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|