Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 2695435..2695742 | Replicon | chromosome |
| Accession | NZ_CP113105 | ||
| Organism | Staphylococcus aureus strain BIAI 117 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | OSZ56_RS13260 | Protein ID | WP_011447039.1 |
| Coordinates | 2695435..2695611 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2695603..2695742 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSZ56_RS13240 (2690670) | 2690670..2694455 | + | 3786 | WP_075111493.1 | phage tail spike protein | - |
| OSZ56_RS13245 (2694445) | 2694445..2694597 | + | 153 | WP_001153681.1 | hypothetical protein | - |
| OSZ56_RS13250 (2694644) | 2694644..2694931 | + | 288 | WP_001040261.1 | hypothetical protein | - |
| OSZ56_RS13255 (2694989) | 2694989..2695285 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| OSZ56_RS13260 (2695435) | 2695435..2695611 | + | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - (2695603) | 2695603..2695742 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (2695603) | 2695603..2695742 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (2695603) | 2695603..2695742 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (2695603) | 2695603..2695742 | - | 140 | NuclAT_0 | - | Antitoxin |
| OSZ56_RS13265 (2695664) | 2695664..2695771 | - | 108 | WP_001791821.1 | hypothetical protein | - |
| OSZ56_RS13270 (2695823) | 2695823..2696077 | + | 255 | WP_000611512.1 | phage holin | - |
| OSZ56_RS13275 (2696089) | 2696089..2696844 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| OSZ56_RS13280 (2697034) | 2697034..2697525 | + | 492 | WP_000920041.1 | staphylokinase | - |
| OSZ56_RS13285 (2698126) | 2698126..2698460 | + | 335 | Protein_2575 | SH3 domain-containing protein | - |
| OSZ56_RS13290 (2698555) | 2698555..2699004 | - | 450 | WP_000727645.1 | chemotaxis-inhibiting protein CHIPS | - |
| OSZ56_RS13295 (2699687) | 2699687..2700037 | + | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| OSZ56_RS13300 (2700090) | 2700090..2700350 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | groEL / hlb / sak / chp / scn | 2633249..2700037 | 66788 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T265417 WP_011447039.1 NZ_CP113105:2695435-2695611 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT265417 NZ_CP113105:c2695742-2695603 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
