Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 2695435..2695773 | Replicon | chromosome |
Accession | NZ_CP113105 | ||
Organism | Staphylococcus aureus strain BIAI 117 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | OSZ56_RS13260 | Protein ID | WP_011447039.1 |
Coordinates | 2695435..2695611 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2695599..2695773 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSZ56_RS13240 | 2690670..2694455 | + | 3786 | WP_075111493.1 | phage tail spike protein | - |
OSZ56_RS13245 | 2694445..2694597 | + | 153 | WP_001153681.1 | hypothetical protein | - |
OSZ56_RS13250 | 2694644..2694931 | + | 288 | WP_001040261.1 | hypothetical protein | - |
OSZ56_RS13255 | 2694989..2695285 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
OSZ56_RS13260 | 2695435..2695611 | + | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- | 2695599..2695773 | - | 175 | - | - | Antitoxin |
OSZ56_RS13270 | 2695823..2696077 | + | 255 | WP_000611512.1 | phage holin | - |
OSZ56_RS13275 | 2696089..2696844 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
OSZ56_RS13280 | 2697034..2697525 | + | 492 | WP_000920041.1 | staphylokinase | - |
OSZ56_RS13285 | 2698126..2698460 | + | 335 | Protein_2575 | SH3 domain-containing protein | - |
OSZ56_RS13290 | 2698555..2699004 | - | 450 | WP_000727645.1 | chemotaxis-inhibiting protein CHIPS | - |
OSZ56_RS13295 | 2699687..2700037 | + | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
OSZ56_RS13300 | 2700090..2700350 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | groEL / hlb / sak / chp / scn | 2633249..2700037 | 66788 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T265415 WP_011447039.1 NZ_CP113105:2695435-2695611 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT265415 NZ_CP113105:c2695773-2695599 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|