Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2506581..2506843 | Replicon | chromosome |
Accession | NZ_CP113105 | ||
Organism | Staphylococcus aureus strain BIAI 117 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | OSZ56_RS12180 | Protein ID | WP_073392962.1 |
Coordinates | 2506581..2506685 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF2 | ||
Locus tag | - | ||
Coordinates | 2506680..2506843 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSZ56_RS12165 | 2503377..2504159 | + | 783 | WP_000908186.1 | ABC transporter ATP-binding protein | - |
OSZ56_RS12170 | 2504227..2505084 | + | 858 | WP_000370937.1 | HAD family hydrolase | - |
OSZ56_RS12175 | 2505743..2505901 | - | 159 | WP_078171426.1 | integrase | - |
OSZ56_RS12180 | 2506581..2506685 | + | 105 | WP_073392962.1 | hypothetical protein | Toxin |
- | 2506680..2506843 | - | 164 | - | - | Antitoxin |
OSZ56_RS12190 | 2507370..2509016 | + | 1647 | WP_000277709.1 | IS1182-like element ISSau3 family transposase | - |
OSZ56_RS12195 | 2509045..2510136 | - | 1092 | WP_064127636.1 | hypothetical protein | - |
OSZ56_RS12200 | 2510402..2511382 | - | 981 | WP_000019741.1 | CDF family zinc efflux transporter CzrB | - |
OSZ56_RS12205 | 2511384..2511704 | - | 321 | WP_053862123.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2507370..2509016 | 1646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3920.80 Da Isoelectric Point: 5.5724
>T265410 WP_073392962.1 NZ_CP113105:2506581-2506685 [Staphylococcus aureus]
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 164 bp
>AT265410 NZ_CP113105:c2506843-2506680 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAATGCCGGTCAAAGCGAATAGAAGGTT
ATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAATGCCGGTCAAAGCGAATAGAAGGTT
ATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|