Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2220854..2221038 | Replicon | chromosome |
Accession | NZ_CP113105 | ||
Organism | Staphylococcus aureus strain BIAI 117 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | OSZ56_RS10675 | Protein ID | WP_000482647.1 |
Coordinates | 2220854..2220961 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2220978..2221038 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSZ56_RS10650 | 2216216..2216689 | + | 474 | WP_000456496.1 | GyrI-like domain-containing protein | - |
OSZ56_RS10655 | 2216812..2218023 | - | 1212 | WP_001191919.1 | multidrug effflux MFS transporter | - |
OSZ56_RS10660 | 2218205..2218864 | - | 660 | WP_000831298.1 | membrane protein | - |
OSZ56_RS10665 | 2218924..2220066 | - | 1143 | Protein_2065 | glycerate kinase | - |
OSZ56_RS10670 | 2220334..2220720 | + | 387 | WP_000779351.1 | flippase GtxA | - |
OSZ56_RS10675 | 2220854..2220961 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2220978..2221038 | - | 61 | - | - | Antitoxin |
OSZ56_RS10680 | 2221609..2223372 | + | 1764 | WP_001064829.1 | ABC transporter ATP-binding protein | - |
OSZ56_RS10685 | 2223397..2225130 | + | 1734 | WP_000486505.1 | ABC transporter ATP-binding protein | - |
OSZ56_RS10690 | 2225361..2225528 | + | 168 | Protein_2070 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T265408 WP_000482647.1 NZ_CP113105:2220854-2220961 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT265408 NZ_CP113105:c2221038-2220978 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|