Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3957997..3958673 | Replicon | chromosome |
| Accession | NZ_CP113103 | ||
| Organism | Streptomyces sp. NA13 | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | D6AZC1 |
| Locus tag | OSU72_RS17270 | Protein ID | WP_003949888.1 |
| Coordinates | 3957997..3958359 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OSU72_RS17275 | Protein ID | WP_018471255.1 |
| Coordinates | 3958356..3958673 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSU72_RS17240 (OSU72_17240) | 3953283..3954353 | - | 1071 | WP_267813570.1 | ATP-binding protein/SpoIIE family protein phosphatase | - |
| OSU72_RS17245 (OSU72_17245) | 3954350..3954766 | - | 417 | WP_003949884.1 | ATP-binding protein | - |
| OSU72_RS17250 (OSU72_17250) | 3954766..3955146 | - | 381 | WP_003949885.1 | STAS domain-containing protein | - |
| OSU72_RS17255 (OSU72_17255) | 3955143..3955997 | - | 855 | WP_018893839.1 | STAS domain-containing protein | - |
| OSU72_RS17260 (OSU72_17260) | 3956301..3956543 | + | 243 | WP_037844511.1 | hypothetical protein | - |
| OSU72_RS17265 (OSU72_17265) | 3956721..3957998 | - | 1278 | WP_267812553.1 | hypothetical protein | - |
| OSU72_RS17270 (OSU72_17270) | 3957997..3958359 | + | 363 | WP_003949888.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OSU72_RS17275 (OSU72_17275) | 3958356..3958673 | + | 318 | WP_018471255.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OSU72_RS17280 (OSU72_17280) | 3958752..3959534 | - | 783 | WP_003949890.1 | ABC transporter permease | - |
| OSU72_RS17285 (OSU72_17285) | 3959531..3960505 | - | 975 | WP_267813571.1 | ATP-binding cassette domain-containing protein | - |
| OSU72_RS17290 (OSU72_17290) | 3960609..3961478 | - | 870 | WP_267812555.1 | DUF4097 family beta strand repeat-containing protein | - |
| OSU72_RS17295 (OSU72_17295) | 3961580..3962110 | - | 531 | WP_003949893.1 | toxin-antitoxin system HicB family antitoxin | - |
| OSU72_RS17300 (OSU72_17300) | 3962316..3963377 | - | 1062 | WP_267812556.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13472.34 Da Isoelectric Point: 4.7680
>T265404 WP_003949888.1 NZ_CP113103:3957997-3958359 [Streptomyces sp. NA13]
MDGEWQIFLVDEVRVWLASLDGAAHARVVQALDVLAEEGPALGRPLVDTLRGSAVANLKELRPGTVRILFAFDPWRSSIL
LVAGDKSGQRTEWYQEAIPLAEQRYALYLKEREREEGGRP
MDGEWQIFLVDEVRVWLASLDGAAHARVVQALDVLAEEGPALGRPLVDTLRGSAVANLKELRPGTVRILFAFDPWRSSIL
LVAGDKSGQRTEWYQEAIPLAEQRYALYLKEREREEGGRP
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|