Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 105880..106701 | Replicon | plasmid unnamed1 |
Accession | NZ_CP113086 | ||
Organism | Pantoea agglomerans strain AB378 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | OSE17_RS19220 | Protein ID | WP_010247344.1 |
Coordinates | 105880..106350 (-) | Length | 157 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | - |
Locus tag | OSE17_RS19225 | Protein ID | WP_033768537.1 |
Coordinates | 106357..106701 (-) | Length | 115 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSE17_RS19210 (OSE17_19210) | 101205..103607 | + | 2403 | WP_267713314.1 | maltodextrin phosphorylase | - |
OSE17_RS19215 (OSE17_19215) | 103616..105691 | + | 2076 | WP_191914086.1 | 4-alpha-glucanotransferase | - |
OSE17_RS19220 (OSE17_19220) | 105880..106350 | - | 471 | WP_010247344.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
OSE17_RS19225 (OSE17_19225) | 106357..106701 | - | 345 | WP_033768537.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
OSE17_RS19230 (OSE17_19230) | 106800..106967 | - | 168 | WP_244649673.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
OSE17_RS19235 (OSE17_19235) | 107204..108142 | - | 939 | WP_191914085.1 | maltose operon protein MalM | - |
OSE17_RS19240 (OSE17_19240) | 108245..109546 | - | 1302 | WP_033760237.1 | maltoporin | - |
OSE17_RS19245 (OSE17_19245) | 109590..110699 | - | 1110 | WP_031594250.1 | maltose/maltodextrin ABC transporter ATP-binding protein MalK | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | iroN | 1..555125 | 555125 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 18278.80 Da Isoelectric Point: 8.9277
>T265381 WP_010247344.1 NZ_CP113086:c106350-105880 [Pantoea agglomerans]
MEDSTVINGWHVYVHPCFESQLIALTNEVELLRAKYPESYQRKATTKLLAAVFKVINSEICADPHQAKFRQGDTLGEQNK
HWFRAKFLMQYRLFFRFSEQHKTIILAWMNDAETKRAYGSKRDAYKVFSGMLHNGYPPDDWALLLKQSQDWANTNS
MEDSTVINGWHVYVHPCFESQLIALTNEVELLRAKYPESYQRKATTKLLAAVFKVINSEICADPHQAKFRQGDTLGEQNK
HWFRAKFLMQYRLFFRFSEQHKTIILAWMNDAETKRAYGSKRDAYKVFSGMLHNGYPPDDWALLLKQSQDWANTNS
Download Length: 471 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|