Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2538403..2539133 | Replicon | chromosome |
Accession | NZ_CP113085 | ||
Organism | Pantoea agglomerans strain AB378 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OSE17_RS11450 | Protein ID | WP_163851839.1 |
Coordinates | 2538816..2539133 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OSE17_RS11445 | Protein ID | WP_010258577.1 |
Coordinates | 2538403..2538735 (-) | Length | 111 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSE17_RS11425 (OSE17_11425) | 2533781..2534422 | + | 642 | WP_003849160.1 | protein phosphatase CheZ | - |
OSE17_RS11430 (OSE17_11430) | 2534611..2535762 | + | 1152 | WP_010258565.1 | flagellar biosynthesis protein FlhB | - |
OSE17_RS11435 (OSE17_11435) | 2535755..2537848 | + | 2094 | WP_010258569.1 | flagellar biosynthesis protein FlhA | - |
OSE17_RS11440 (OSE17_11440) | 2537848..2538240 | + | 393 | WP_172608759.1 | flagellar protein FlhE | - |
OSE17_RS11445 (OSE17_11445) | 2538403..2538735 | - | 333 | WP_010258577.1 | HigA family addiction module antitoxin | Antitoxin |
OSE17_RS11450 (OSE17_11450) | 2538816..2539133 | - | 318 | WP_163851839.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OSE17_RS11455 (OSE17_11455) | 2539208..2540206 | - | 999 | WP_172608757.1 | aldo/keto reductase | - |
OSE17_RS11460 (OSE17_11460) | 2540419..2541354 | - | 936 | WP_172608756.1 | LysR family transcriptional regulator | - |
OSE17_RS11465 (OSE17_11465) | 2541442..2543172 | - | 1731 | WP_010258588.1 | arginine--tRNA ligase | - |
OSE17_RS11470 (OSE17_11470) | 2543383..2543505 | - | 123 | WP_009089698.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12311.17 Da Isoelectric Point: 10.2104
>T265378 WP_163851839.1 NZ_CP113085:c2539133-2538816 [Pantoea agglomerans]
VATLRNIESFRDDWLKDYFLYGKFSKRIPSSLSSALARKLDIINAAISYKDLKSPPGNRYEELNPPLKGYASIRVNEQYR
LIFKWIEGKAVDLYLDAHSYKKHKR
VATLRNIESFRDDWLKDYFLYGKFSKRIPSSLSSALARKLDIINAAISYKDLKSPPGNRYEELNPPLKGYASIRVNEQYR
LIFKWIEGKAVDLYLDAHSYKKHKR
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|