Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2356688..2357348 | Replicon | chromosome |
| Accession | NZ_CP113085 | ||
| Organism | Pantoea agglomerans strain AB378 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A349IFT5 |
| Locus tag | OSE17_RS10610 | Protein ID | WP_010670918.1 |
| Coordinates | 2356688..2357041 (+) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OSE17_RS10615 | Protein ID | WP_172608024.1 |
| Coordinates | 2357046..2357348 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSE17_RS10590 (OSE17_10590) | 2351885..2352166 | + | 282 | WP_010247933.1 | hypothetical protein | - |
| OSE17_RS10595 (OSE17_10595) | 2352265..2352666 | + | 402 | WP_010247930.1 | cell envelope integrity TolA C-terminal domain-containing protein | - |
| OSE17_RS10600 (OSE17_10600) | 2352743..2354905 | - | 2163 | WP_172608023.1 | ferric-rhodotorulic acid/ferric-coprogen receptor FhuE | - |
| OSE17_RS10605 (OSE17_10605) | 2355301..2356389 | + | 1089 | WP_029519393.1 | YncE family protein | - |
| OSE17_RS10610 (OSE17_10610) | 2356688..2357041 | + | 354 | WP_010670918.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OSE17_RS10615 (OSE17_10615) | 2357046..2357348 | + | 303 | WP_172608024.1 | XRE family transcriptional regulator | Antitoxin |
| OSE17_RS10625 (OSE17_10625) | 2358020..2358943 | + | 924 | WP_031591254.1 | sugar ABC transporter substrate-binding protein | - |
| OSE17_RS10630 (OSE17_10630) | 2358976..2360459 | + | 1484 | Protein_2047 | sugar ABC transporter ATP-binding protein | - |
| OSE17_RS10635 (OSE17_10635) | 2360483..2361508 | + | 1026 | WP_267713243.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13649.71 Da Isoelectric Point: 8.4949
>T265377 WP_010670918.1 NZ_CP113085:2356688-2357041 [Pantoea agglomerans]
VWMIKTTERFDRWFTLLNESDRACVLAALMVLREKGPGLSRPYADTLKGSVYINMKELRIQSRGDPIRAFFAFDPNRTAI
VLCAGNKVGNEKRFYQEMLPVADREFTHWLNSFKDEE
VWMIKTTERFDRWFTLLNESDRACVLAALMVLREKGPGLSRPYADTLKGSVYINMKELRIQSRGDPIRAFFAFDPNRTAI
VLCAGNKVGNEKRFYQEMLPVADREFTHWLNSFKDEE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|