Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 507158..507810 | Replicon | chromosome |
Accession | NZ_CP113085 | ||
Organism | Pantoea agglomerans strain AB378 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A8X8DRT2 |
Locus tag | OSE17_RS02240 | Protein ID | WP_010672045.1 |
Coordinates | 507158..507511 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A8X8DRN0 |
Locus tag | OSE17_RS02245 | Protein ID | WP_010252120.1 |
Coordinates | 507511..507810 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSE17_RS02225 (OSE17_02225) | 502884..504668 | - | 1785 | WP_172608722.1 | GMC family oxidoreductase | - |
OSE17_RS02230 (OSE17_02230) | 504671..505405 | - | 735 | WP_010672043.1 | gluconate 2-dehydrogenase subunit 3 family protein | - |
OSE17_RS02235 (OSE17_02235) | 505682..506923 | + | 1242 | WP_033770848.1 | peptide antibiotic transporter SbmA | - |
OSE17_RS02240 (OSE17_02240) | 507158..507511 | + | 354 | WP_010672045.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OSE17_RS02245 (OSE17_02245) | 507511..507810 | + | 300 | WP_010252120.1 | XRE family transcriptional regulator | Antitoxin |
OSE17_RS02250 (OSE17_02250) | 507933..508985 | - | 1053 | WP_010672046.1 | YncE family protein | - |
OSE17_RS02255 (OSE17_02255) | 509188..509397 | - | 210 | WP_009092571.1 | DUF1471 domain-containing protein | - |
OSE17_RS02260 (OSE17_02260) | 509610..510797 | - | 1188 | WP_158149645.1 | MFS transporter | - |
OSE17_RS02265 (OSE17_02265) | 510902..511867 | + | 966 | WP_267712858.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13660.67 Da Isoelectric Point: 7.9792
>T265375 WP_010672045.1 NZ_CP113085:507158-507511 [Pantoea agglomerans]
MWTVLLSPRFESWLSEQEEALQEKMLADLGKLKVYGPDLPRPYADTLKGSQYRNMKELRVQFSGKPIRAFYAFDPVRQAI
VLCAGDKSHDKRFYIRMIRIADDEFSAWLAEQEKGNN
MWTVLLSPRFESWLSEQEEALQEKMLADLGKLKVYGPDLPRPYADTLKGSQYRNMKELRVQFSGKPIRAFYAFDPVRQAI
VLCAGDKSHDKRFYIRMIRIADDEFSAWLAEQEKGNN
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|