Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 16563..17221 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP113081 | ||
| Organism | Acinetobacter baumannii strain AB5075-T | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | OSV62_RS19245 | Protein ID | WP_000312250.1 |
| Coordinates | 16563..16922 (+) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OSV62_RS19250 | Protein ID | WP_001096429.1 |
| Coordinates | 16922..17221 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSV62_RS19210 (OSV62_19210) | 11889..12881 | - | 993 | WP_001381192.1 | TniB family NTP-binding protein | - |
| OSV62_RS19215 (OSV62_19215) | 12884..13291 | - | 408 | Protein_15 | Mu transposase C-terminal domain-containing protein | - |
| OSV62_RS19220 (OSV62_19220) | 13708..14211 | - | 504 | WP_001053125.1 | hypothetical protein | - |
| OSV62_RS19225 (OSV62_19225) | 14278..14661 | - | 384 | WP_000654348.1 | hypothetical protein | - |
| OSV62_RS19230 (OSV62_19230) | 14800..15498 | - | 699 | WP_000873188.1 | hypothetical protein | - |
| OSV62_RS19235 (OSV62_19235) | 15565..15747 | - | 183 | WP_000373385.1 | hypothetical protein | - |
| OSV62_RS19240 (OSV62_19240) | 15796..16362 | - | 567 | WP_000710385.1 | hypothetical protein | - |
| OSV62_RS19245 (OSV62_19245) | 16563..16922 | + | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OSV62_RS19250 (OSV62_19250) | 16922..17221 | + | 300 | WP_001096429.1 | XRE family transcriptional regulator | Antitoxin |
| OSV62_RS19255 (OSV62_19255) | 17758..18294 | - | 537 | WP_000731978.1 | hypothetical protein | - |
| OSV62_RS19260 (OSV62_19260) | 18344..18898 | - | 555 | WP_000790084.1 | hypothetical protein | - |
| OSV62_RS19265 (OSV62_19265) | 18918..19136 | - | 219 | WP_001043201.1 | hypothetical protein | - |
| OSV62_RS19270 (OSV62_19270) | 19176..19805 | - | 630 | WP_000701003.1 | hypothetical protein | - |
| OSV62_RS19275 (OSV62_19275) | 19822..20001 | - | 180 | WP_000387630.1 | hypothetical protein | - |
| OSV62_RS19280 (OSV62_19280) | 19977..20549 | - | 573 | WP_000443897.1 | hypothetical protein | - |
| OSV62_RS19285 (OSV62_19285) | 20554..20811 | - | 258 | WP_000834290.1 | hypothetical protein | - |
| OSV62_RS19290 (OSV62_19290) | 20916..22196 | - | 1281 | WP_001093570.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | ant(2'')-Ia / cmlA1 / aadA2 / aph(3'')-Ib / aph(6)-Id / blaGES-11 / aac(6')-Ib / dfrA7 / qacE / sul1 / aph(3')-VIa | - | 1..83610 | 83610 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T265368 WP_000312250.1 NZ_CP113081:16563-16922 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|