Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 16563..17221 Replicon plasmid unnamed2
Accession NZ_CP113081
Organism Acinetobacter baumannii strain AB5075-T

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag OSV62_RS19245 Protein ID WP_000312250.1
Coordinates 16563..16922 (+) Length 120 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OSV62_RS19250 Protein ID WP_001096429.1
Coordinates 16922..17221 (+) Length 100 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OSV62_RS19210 (OSV62_19210) 11889..12881 - 993 WP_001381192.1 TniB family NTP-binding protein -
OSV62_RS19215 (OSV62_19215) 12884..13291 - 408 Protein_15 Mu transposase C-terminal domain-containing protein -
OSV62_RS19220 (OSV62_19220) 13708..14211 - 504 WP_001053125.1 hypothetical protein -
OSV62_RS19225 (OSV62_19225) 14278..14661 - 384 WP_000654348.1 hypothetical protein -
OSV62_RS19230 (OSV62_19230) 14800..15498 - 699 WP_000873188.1 hypothetical protein -
OSV62_RS19235 (OSV62_19235) 15565..15747 - 183 WP_000373385.1 hypothetical protein -
OSV62_RS19240 (OSV62_19240) 15796..16362 - 567 WP_000710385.1 hypothetical protein -
OSV62_RS19245 (OSV62_19245) 16563..16922 + 360 WP_000312250.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OSV62_RS19250 (OSV62_19250) 16922..17221 + 300 WP_001096429.1 XRE family transcriptional regulator Antitoxin
OSV62_RS19255 (OSV62_19255) 17758..18294 - 537 WP_000731978.1 hypothetical protein -
OSV62_RS19260 (OSV62_19260) 18344..18898 - 555 WP_000790084.1 hypothetical protein -
OSV62_RS19265 (OSV62_19265) 18918..19136 - 219 WP_001043201.1 hypothetical protein -
OSV62_RS19270 (OSV62_19270) 19176..19805 - 630 WP_000701003.1 hypothetical protein -
OSV62_RS19275 (OSV62_19275) 19822..20001 - 180 WP_000387630.1 hypothetical protein -
OSV62_RS19280 (OSV62_19280) 19977..20549 - 573 WP_000443897.1 hypothetical protein -
OSV62_RS19285 (OSV62_19285) 20554..20811 - 258 WP_000834290.1 hypothetical protein -
OSV62_RS19290 (OSV62_19290) 20916..22196 - 1281 WP_001093570.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid ant(2'')-Ia / cmlA1 / aadA2 / aph(3'')-Ib / aph(6)-Id / blaGES-11 / aac(6')-Ib / dfrA7 / qacE / sul1 / aph(3')-VIa - 1..83610 83610


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(14-109)

Antitoxin

HigA2-like, helix-turn-helix domain

(12-88)


Sequences

Toxin        


Download         Length: 120 a.a.        Molecular weight: 13751.62 Da        Isoelectric Point: 4.8212

>T265368 WP_000312250.1 NZ_CP113081:16563-16922 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK

Download         Length: 360 bp

Antitoxin


Download         Length: 100 a.a.        Molecular weight: 11012.93 Da        Isoelectric Point: 10.4856

>AT265368 WP_001096429.1 NZ_CP113081:16922-17221 [Acinetobacter baumannii]
MAKLNDIISKRSPESQQRIKKMANQMLLDINLSNLREELKISQAEIAKNLGVSQAAISKREKLGKDLKISSLKEYVEAMG
GKVRLDVELPNGKHVAISI

Download         Length: 300 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References