Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 16685..17343 Replicon plasmid unnamed
Accession NZ_CP113079
Organism Acinetobacter baumannii strain AB5075

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag OSV63_RS19535 Protein ID WP_000312250.1
Coordinates 16685..17044 (+) Length 120 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OSV63_RS19540 Protein ID WP_001096429.1
Coordinates 17044..17343 (+) Length 100 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OSV63_RS19500 (OSV63_19500) 12011..13003 - 993 WP_001381192.1 TniB family NTP-binding protein -
OSV63_RS19505 (OSV63_19505) 13006..13413 - 408 Protein_15 Mu transposase C-terminal domain-containing protein -
OSV63_RS19510 (OSV63_19510) 13830..14333 - 504 WP_001053125.1 hypothetical protein -
OSV63_RS19515 (OSV63_19515) 14400..14783 - 384 WP_000654348.1 hypothetical protein -
OSV63_RS19520 (OSV63_19520) 14922..15620 - 699 WP_000873188.1 hypothetical protein -
OSV63_RS19525 (OSV63_19525) 15687..15869 - 183 WP_000373385.1 hypothetical protein -
OSV63_RS19530 (OSV63_19530) 15918..16484 - 567 WP_000710385.1 hypothetical protein -
OSV63_RS19535 (OSV63_19535) 16685..17044 + 360 WP_000312250.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OSV63_RS19540 (OSV63_19540) 17044..17343 + 300 WP_001096429.1 XRE family transcriptional regulator Antitoxin
OSV63_RS19545 (OSV63_19545) 17880..18416 - 537 WP_000731978.1 hypothetical protein -
OSV63_RS19550 (OSV63_19550) 18466..19020 - 555 WP_000790084.1 hypothetical protein -
OSV63_RS19555 (OSV63_19555) 19040..19258 - 219 WP_001043201.1 hypothetical protein -
OSV63_RS19560 (OSV63_19560) 19298..19927 - 630 WP_000701003.1 hypothetical protein -
OSV63_RS19565 (OSV63_19565) 19944..20123 - 180 WP_000387630.1 hypothetical protein -
OSV63_RS19570 (OSV63_19570) 20099..20671 - 573 WP_000443897.1 hypothetical protein -
OSV63_RS19575 (OSV63_19575) 20676..20933 - 258 WP_000834290.1 hypothetical protein -
OSV63_RS19580 (OSV63_19580) 21038..22318 - 1281 WP_001093570.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid ant(2'')-Ia / cmlA1 / aadA2 / aph(3'')-Ib / aph(6)-Id / blaGES-11 / aac(6')-Ib / dfrA7 / qacE / sul1 / aph(3')-VIa - 1..83610 83610


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(14-109)

Antitoxin

HigA2-like, helix-turn-helix domain

(12-88)


Sequences

Toxin        


Download         Length: 120 a.a.        Molecular weight: 13751.62 Da        Isoelectric Point: 4.8212

>T265366 WP_000312250.1 NZ_CP113079:16685-17044 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK

Download         Length: 360 bp

Antitoxin


Download         Length: 100 a.a.        Molecular weight: 11012.93 Da        Isoelectric Point: 10.4856

>AT265366 WP_001096429.1 NZ_CP113079:17044-17343 [Acinetobacter baumannii]
MAKLNDIISKRSPESQQRIKKMANQMLLDINLSNLREELKISQAEIAKNLGVSQAAISKREKLGKDLKISSLKEYVEAMG
GKVRLDVELPNGKHVAISI

Download         Length: 300 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References