Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2869899..2870081 | Replicon | chromosome |
| Accession | NZ_CP113052 | ||
| Organism | Staphylococcus aureus strain Fizz | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | OS084_RS14435 | Protein ID | WP_001801861.1 |
| Coordinates | 2869899..2869994 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2870022..2870081 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS084_RS14395 | 2865559..2866185 | + | 627 | Protein_2796 | hypothetical protein | - |
| OS084_RS14400 | 2866226..2866570 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| OS084_RS14405 | 2866668..2867219 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| OS084_RS14410 | 2867437..2868078 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| OS084_RS14415 | 2868192..2868377 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| OS084_RS14420 | 2868379..2868555 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| OS084_RS14425 | 2868566..2868949 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| OS084_RS14430 | 2869553..2869696 | - | 144 | WP_001549059.1 | transposase | - |
| OS084_RS14435 | 2869899..2869994 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 2870022..2870081 | - | 60 | - | - | Antitoxin |
| OS084_RS14440 | 2870117..2870218 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| OS084_RS14445 | 2870196..2870372 | - | 177 | Protein_2806 | transposase | - |
| OS084_RS14450 | 2870566..2870943 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T265350 WP_001801861.1 NZ_CP113052:2869899-2869994 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT265350 NZ_CP113052:c2870081-2870022 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|