Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprG-sprF/-
Location 328382..328599 Replicon chromosome
Accession NZ_CP113052
Organism Staphylococcus aureus strain Fizz

Toxin (Protein)


Gene name SprG3 Uniprot ID Q2FWA7
Locus tag OS084_RS01955 Protein ID WP_001802298.1
Coordinates 328495..328599 (-) Length 35 a.a.

Antitoxin (RNA)


Gene name SprF2
Locus tag -
Coordinates 328382..328437 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS084_RS01930 324519..325184 - 666 WP_001024094.1 SDR family oxidoreductase -
OS084_RS01935 325336..325656 + 321 WP_000003759.1 Zn(II)-responsive metalloregulatory transcriptional repressor CzrA -
OS084_RS01940 325658..326638 + 981 WP_000019744.1 CDF family zinc efflux transporter CzrB -
OS084_RS01945 326904..327995 + 1092 WP_000495671.1 lytic regulatory protein -
- 328382..328437 + 56 - - Antitoxin
OS084_RS01955 328495..328599 - 105 WP_001802298.1 hypothetical protein Toxin
OS084_RS01960 328760..329243 - 484 Protein_347 recombinase family protein -
OS084_RS01965 329286..330422 - 1137 WP_000115564.1 SAP domain-containing protein -
OS084_RS01970 330711..330803 + 93 WP_001790138.1 hypothetical protein -
OS084_RS01975 331092..331276 + 185 Protein_350 exotoxin -
OS084_RS01980 331508..332365 - 858 WP_000370924.1 HAD family hydrolase -
OS084_RS01985 332433..333215 - 783 WP_000908176.1 ABC transporter ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 35 a.a.        Molecular weight: 3906.77 Da        Isoelectric Point: 5.5724

>T265345 WP_001802298.1 NZ_CP113052:c328599-328495 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK

Download         Length: 105 bp

Antitoxin


Download         Length: 56 bp

>AT265345 NZ_CP113052:328382-328437 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y9L9

Antitoxin

Download structure file

References