Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 153714..154013 | Replicon | chromosome |
Accession | NZ_CP113052 | ||
Organism | Staphylococcus aureus strain Fizz |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | OS084_RS00960 | Protein ID | WP_011447039.1 |
Coordinates | 153837..154013 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 153714..153769 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS084_RS00920 | 149045..149305 | + | 261 | WP_001791826.1 | hypothetical protein | - |
OS084_RS00925 | 149358..149708 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
OS084_RS00930 | 150393..150842 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
OS084_RS00935 | 150937..151272 | - | 336 | Protein_147 | SH3 domain-containing protein | - |
OS084_RS00940 | 151922..152413 | - | 492 | WP_000919350.1 | staphylokinase | - |
OS084_RS00945 | 152604..153359 | - | 756 | WP_031785843.1 | CHAP domain-containing protein | - |
OS084_RS00950 | 153371..153625 | - | 255 | WP_000611512.1 | phage holin | - |
OS084_RS00955 | 153677..153784 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 153706..153845 | + | 140 | NuclAT_0 | - | - |
- | 153706..153845 | + | 140 | NuclAT_0 | - | - |
- | 153706..153845 | + | 140 | NuclAT_0 | - | - |
- | 153706..153845 | + | 140 | NuclAT_0 | - | - |
- | 153714..153769 | + | 56 | - | - | Antitoxin |
OS084_RS00960 | 153837..154013 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
OS084_RS00965 | 154163..154459 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
OS084_RS00970 | 154517..154804 | - | 288 | WP_001040261.1 | hypothetical protein | - |
OS084_RS00975 | 154851..155003 | - | 153 | WP_001153681.1 | hypothetical protein | - |
OS084_RS00980 | 154993..158778 | - | 3786 | WP_000582165.1 | phage tail spike protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 149358..205306 | 55948 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T265340 WP_011447039.1 NZ_CP113052:c154013-153837 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT265340 NZ_CP113052:153714-153769 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|