Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2121067..2121251 | Replicon | chromosome |
Accession | NZ_CP113051 | ||
Organism | Staphylococcus aureus strain Viktor |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | OS088_RS10960 | Protein ID | WP_000482647.1 |
Coordinates | 2121144..2121251 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2121067..2121127 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS088_RS10935 | 2116619..2117734 | - | 1116 | WP_154283952.1 | pyridoxal phosphate-dependent aminotransferase family protein | - |
OS088_RS10940 | 2117712..2118719 | - | 1008 | WP_001046645.1 | biotin synthase BioB | - |
OS088_RS10945 | 2118721..2120079 | - | 1359 | WP_154283953.1 | adenosylmethionine--8-amino-7-oxononanoate transaminase | - |
OS088_RS10950 | 2120057..2120743 | - | 687 | WP_154283954.1 | dethiobiotin synthase | - |
OS088_RS10955 | 2120798..2120965 | - | 168 | WP_001789205.1 | hypothetical protein | - |
- | 2121067..2121127 | + | 61 | - | - | Antitoxin |
OS088_RS10960 | 2121144..2121251 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
OS088_RS10965 | 2121385..2121771 | - | 387 | WP_000779356.1 | flippase GtxA | - |
OS088_RS10970 | 2122039..2123181 | + | 1143 | WP_154283957.1 | glycerate kinase | - |
OS088_RS10975 | 2123241..2123900 | + | 660 | WP_000831298.1 | membrane protein | - |
OS088_RS10980 | 2124079..2125290 | + | 1212 | WP_154283958.1 | multidrug effflux MFS transporter | - |
OS088_RS10985 | 2125413..2125886 | - | 474 | WP_154283959.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T265337 WP_000482647.1 NZ_CP113051:c2121251-2121144 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT265337 NZ_CP113051:2121067-2121127 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTATTGCCCTAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTATTGCCCTAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|