Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) SprA2-SprA2AS/-
Location 2121067..2121251 Replicon chromosome
Accession NZ_CP113051
Organism Staphylococcus aureus strain Viktor

Toxin (Protein)


Gene name SprA2 Uniprot ID A0A2P7CQJ7
Locus tag OS088_RS10960 Protein ID WP_000482647.1
Coordinates 2121144..2121251 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name SprA2AS
Locus tag -
Coordinates 2121067..2121127 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS088_RS10935 2116619..2117734 - 1116 WP_154283952.1 pyridoxal phosphate-dependent aminotransferase family protein -
OS088_RS10940 2117712..2118719 - 1008 WP_001046645.1 biotin synthase BioB -
OS088_RS10945 2118721..2120079 - 1359 WP_154283953.1 adenosylmethionine--8-amino-7-oxononanoate transaminase -
OS088_RS10950 2120057..2120743 - 687 WP_154283954.1 dethiobiotin synthase -
OS088_RS10955 2120798..2120965 - 168 WP_001789205.1 hypothetical protein -
- 2121067..2121127 + 61 - - Antitoxin
OS088_RS10960 2121144..2121251 - 108 WP_000482647.1 type I toxin-antitoxin system Fst family toxin Toxin
OS088_RS10965 2121385..2121771 - 387 WP_000779356.1 flippase GtxA -
OS088_RS10970 2122039..2123181 + 1143 WP_154283957.1 glycerate kinase -
OS088_RS10975 2123241..2123900 + 660 WP_000831298.1 membrane protein -
OS088_RS10980 2124079..2125290 + 1212 WP_154283958.1 multidrug effflux MFS transporter -
OS088_RS10985 2125413..2125886 - 474 WP_154283959.1 GyrI-like domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4012.76 Da        Isoelectric Point: 10.4935

>T265337 WP_000482647.1 NZ_CP113051:c2121251-2121144 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK

Download         Length: 108 bp

Antitoxin


Download         Length: 61 bp

>AT265337 NZ_CP113051:2121067-2121127 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTATTGCCCTAGTGAGGGGA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P7CQJ7

Antitoxin

Download structure file

References