Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 1834203..1834420 | Replicon | chromosome |
| Accession | NZ_CP113051 | ||
| Organism | Staphylococcus aureus strain Viktor | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | OS088_RS09445 | Protein ID | WP_001802298.1 |
| Coordinates | 1834316..1834420 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF2 | ||
| Locus tag | - | ||
| Coordinates | 1834203..1834258 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS088_RS09420 | 1830338..1831003 | - | 666 | WP_001024097.1 | SDR family oxidoreductase | - |
| OS088_RS09425 | 1831155..1831475 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| OS088_RS09430 | 1831477..1832457 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| OS088_RS09435 | 1832723..1833814 | + | 1092 | WP_267814085.1 | transcriptional regulator | - |
| - | 1834203..1834258 | + | 56 | - | - | Antitoxin |
| OS088_RS09445 | 1834316..1834420 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| OS088_RS09450 | 1834937..1835107 | + | 171 | WP_001792292.1 | transposase | - |
| OS088_RS09455 | 1835100..1835258 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| OS088_RS09460 | 1835694..1835786 | + | 93 | WP_001794441.1 | hypothetical protein | - |
| OS088_RS09465 | 1835916..1836773 | - | 858 | WP_154284123.1 | HAD family hydrolase | - |
| OS088_RS09470 | 1836841..1837623 | - | 783 | WP_267814087.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T265335 WP_001802298.1 NZ_CP113051:c1834420-1834316 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT265335 NZ_CP113051:1834203-1834258 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|