Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 1660110..1660417 | Replicon | chromosome |
| Accession | NZ_CP113051 | ||
| Organism | Staphylococcus aureus strain Viktor | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | OS088_RS08460 | Protein ID | WP_011447039.1 |
| Coordinates | 1660241..1660417 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 1660110..1660249 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS088_RS08420 (1655676) | 1655676..1655855 | + | 180 | WP_000669791.1 | hypothetical protein | - |
| OS088_RS08425 (1656166) | 1656166..1656426 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| OS088_RS08430 (1656479) | 1656479..1656829 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| OS088_RS08435 (1657341) | 1657341..1657676 | - | 336 | Protein_1623 | SH3 domain-containing protein | - |
| OS088_RS08440 (1658326) | 1658326..1658817 | - | 492 | WP_000920038.1 | staphylokinase | - |
| OS088_RS08445 (1659008) | 1659008..1659763 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| OS088_RS08450 (1659775) | 1659775..1660029 | - | 255 | WP_000611512.1 | phage holin | - |
| OS088_RS08455 (1660081) | 1660081..1660188 | + | 108 | WP_031762631.1 | hypothetical protein | - |
| - (1660110) | 1660110..1660249 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1660110) | 1660110..1660249 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1660110) | 1660110..1660249 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1660110) | 1660110..1660249 | + | 140 | NuclAT_0 | - | Antitoxin |
| OS088_RS08460 (1660241) | 1660241..1660417 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| OS088_RS08465 (1660526) | 1660526..1661300 | - | 775 | Protein_1629 | staphylococcal enterotoxin type A | - |
| OS088_RS08470 (1661673) | 1661673..1662047 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| OS088_RS08475 (1662103) | 1662103..1662390 | - | 288 | WP_001262621.1 | hypothetical protein | - |
| OS088_RS08480 (1662436) | 1662436..1662588 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / sak / sea / hlb / groEL | 1656479..1707920 | 51441 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T265329 WP_011447039.1 NZ_CP113051:c1660417-1660241 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT265329 NZ_CP113051:1660110-1660249 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
