265325

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 2906210..2906624 Replicon chromosome
Accession NZ_CP113049
Organism Staphylococcus aureus strain Ahri

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag OS089_RS14625 Protein ID WP_001065099.1
Coordinates 2906210..2906461 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OS089_RS14630 Protein ID WP_000028424.1
Coordinates 2906451..2906624 (+) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS089_RS14575 (2901696) 2901696..2902553 - 858 WP_000371250.1 DUF4393 domain-containing protein -
OS089_RS14580 (2902618) 2902618..2903388 + 771 WP_000190224.1 conserved phage C-terminal domain-containing protein -
OS089_RS14585 (2903398) 2903398..2904177 + 780 WP_103143576.1 ATP-binding protein -
OS089_RS14590 (2904171) 2904171..2904332 + 162 WP_000237153.1 hypothetical protein -
OS089_RS14595 (2904345) 2904345..2904566 + 222 WP_001123688.1 DUF3269 family protein -
OS089_RS14600 (2904576) 2904576..2905001 + 426 WP_000451862.1 DNA N-6-adenine-methyltransferase -
OS089_RS14605 (2904998) 2904998..2905402 + 405 WP_021758092.1 DUF1064 domain-containing protein -
OS089_RS14610 (2905407) 2905407..2905592 + 186 WP_001187236.1 DUF3113 family protein -
OS089_RS14615 (2905593) 2905593..2905949 + 357 WP_000029366.1 SA1788 family PVL leukocidin-associated protein -
OS089_RS14620 (2905953) 2905953..2906195 + 243 WP_000131388.1 phi PVL orf 51-like protein -
OS089_RS14625 (2906210) 2906210..2906461 + 252 WP_001065099.1 DUF1024 family protein Toxin
OS089_RS14630 (2906451) 2906451..2906624 + 174 WP_000028424.1 hypothetical protein Antitoxin
OS089_RS14635 (2906625) 2906625..2906906 + 282 WP_267813972.1 hypothetical protein -
OS089_RS14640 (2906907) 2906907..2907068 + 162 WP_000889683.1 hypothetical protein -
OS089_RS14645 (2907083) 2907083..2907589 + 507 WP_001061834.1 dUTPase -
OS089_RS14650 (2907626) 2907626..2907875 + 250 Protein_2847 hypothetical protein -
OS089_RS14655 (2907872) 2907872..2908024 + 153 WP_038412600.1 DUF1381 domain-containing protein -
OS089_RS14660 (2908241) 2908241..2908408 + 168 WP_267813974.1 hypothetical protein -
OS089_RS14665 (2908492) 2908492..2908665 + 174 WP_000595257.1 transcriptional activator RinB -
OS089_RS14670 (2908666) 2908666..2909067 + 402 WP_000286968.1 hypothetical protein -
OS089_RS14675 (2909604) 2909604..2909921 + 318 WP_001806486.1 hypothetical protein -
OS089_RS14680 (2909914) 2909914..2911139 + 1226 Protein_2853 PBSX family phage terminase large subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2882964..2922598 39634


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9376.32 Da        Isoelectric Point: 3.8364

>T265325 WP_001065099.1 NZ_CP113049:2906210-2906461 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILKGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT265325 WP_000028424.1 NZ_CP113049:2906451-2906624 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References