Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2635263..2635526 | Replicon | chromosome |
Accession | NZ_CP113049 | ||
Organism | Staphylococcus aureus strain Ahri |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | OS089_RS13030 | Protein ID | WP_001802298.1 |
Coordinates | 2635263..2635367 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF2 | ||
Locus tag | - | ||
Coordinates | 2635362..2635526 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS089_RS13000 | 2630657..2631439 | + | 783 | WP_000908190.1 | ABC transporter ATP-binding protein | - |
OS089_RS13005 | 2631507..2632364 | + | 858 | WP_000370919.1 | HAD family hydrolase | - |
OS089_RS13010 | 2632558..2632772 | - | 215 | Protein_2563 | exotoxin | - |
OS089_RS13015 | 2633059..2633151 | - | 93 | WP_031844941.1 | hypothetical protein | - |
OS089_RS13020 | 2633440..2634576 | + | 1137 | Protein_2565 | SAP domain-containing protein | - |
OS089_RS13025 | 2634619..2635102 | + | 484 | Protein_2566 | recombinase family protein | - |
OS089_RS13030 | 2635263..2635367 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 2635362..2635526 | - | 165 | - | - | Antitoxin |
OS089_RS13040 | 2635816..2636907 | - | 1092 | WP_000495695.1 | hypothetical protein | - |
OS089_RS13045 | 2637173..2638150 | - | 978 | WP_000019732.1 | CDF family zinc efflux transporter CzrB | - |
OS089_RS13050 | 2638152..2638472 | - | 321 | WP_000139802.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
OS089_RS13055 | 2638624..2639289 | + | 666 | WP_001024088.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T265318 WP_001802298.1 NZ_CP113049:2635263-2635367 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT265318 NZ_CP113049:c2635526-2635362 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|