Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2302489..2302673 | Replicon | chromosome |
Accession | NZ_CP113049 | ||
Organism | Staphylococcus aureus strain Ahri |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | OS089_RS11205 | Protein ID | WP_000482647.1 |
Coordinates | 2302489..2302596 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2302613..2302673 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS089_RS11180 | 2297851..2298324 | + | 474 | WP_000456483.1 | GyrI-like domain-containing protein | - |
OS089_RS11185 | 2298447..2299658 | - | 1212 | WP_001191921.1 | multidrug effflux MFS transporter | - |
OS089_RS11190 | 2299841..2300500 | - | 660 | WP_000831298.1 | membrane protein | - |
OS089_RS11195 | 2300560..2301702 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
OS089_RS11200 | 2301970..2302356 | + | 387 | WP_000779353.1 | flippase GtxA | - |
OS089_RS11205 | 2302489..2302596 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2302613..2302673 | - | 61 | - | - | Antitoxin |
OS089_RS11210 | 2302623..2302790 | + | 168 | WP_000301893.1 | hypothetical protein | - |
OS089_RS11215 | 2303244..2304956 | + | 1713 | WP_001064821.1 | ABC transporter ATP-binding protein | - |
OS089_RS11220 | 2305032..2306765 | + | 1734 | WP_000488493.1 | ABC transporter ATP-binding protein | - |
OS089_RS11225 | 2306996..2307163 | + | 168 | WP_031845053.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T265316 WP_000482647.1 NZ_CP113049:2302489-2302596 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT265316 NZ_CP113049:c2302673-2302613 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|