Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-MW1433/- |
| Location | 54736..55043 | Replicon | chromosome |
| Accession | NZ_CP113049 | ||
| Organism | Staphylococcus aureus strain Ahri | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | OS089_RS00395 | Protein ID | WP_011447039.1 |
| Coordinates | 54736..54912 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | MW1433 | ||
| Locus tag | - | ||
| Coordinates | 54904..55043 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS089_RS00375 (52422) | 52422..52574 | + | 153 | WP_000654329.1 | hypothetical protein | - |
| OS089_RS00380 (52621) | 52621..52909 | + | 289 | Protein_75 | hypothetical protein | - |
| OS089_RS00385 (52965) | 52965..53339 | + | 375 | WP_000340977.1 | hypothetical protein | - |
| OS089_RS00390 (53760) | 53760..54533 | + | 774 | WP_025174055.1 | staphylococcal enterotoxin type P | - |
| OS089_RS00395 (54736) | 54736..54912 | + | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - (54904) | 54904..55043 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (54904) | 54904..55043 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (54904) | 54904..55043 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (54904) | 54904..55043 | - | 140 | NuclAT_0 | - | Antitoxin |
| OS089_RS00400 (54965) | 54965..55072 | - | 108 | WP_031762631.1 | hypothetical protein | - |
| OS089_RS00405 (55124) | 55124..55378 | + | 255 | WP_000611512.1 | phage holin | - |
| OS089_RS00410 (55390) | 55390..56145 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| OS089_RS00415 (56336) | 56336..56827 | + | 492 | WP_000920038.1 | staphylokinase | - |
| OS089_RS00420 (57478) | 57478..57813 | + | 336 | Protein_83 | SH3 domain-containing protein | - |
| OS089_RS00425 (58324) | 58324..58674 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| OS089_RS00430 (58727) | 58727..58987 | - | 261 | WP_001791826.1 | hypothetical protein | - |
| OS089_RS00435 (59298) | 59298..59477 | - | 180 | WP_000669791.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | see / sak / scn | 119..61544 | 61425 | |
| - | inside | Prophage | - | see / sak / scn / hysA | 119..71341 | 71222 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T265313 WP_011447039.1 NZ_CP113049:54736-54912 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT265313 NZ_CP113049:c55043-54904 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|