Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 54736..55074 | Replicon | chromosome |
Accession | NZ_CP113049 | ||
Organism | Staphylococcus aureus strain Ahri |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | OS089_RS00395 | Protein ID | WP_011447039.1 |
Coordinates | 54736..54912 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 54900..55074 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS089_RS00375 | 52422..52574 | + | 153 | WP_000654329.1 | hypothetical protein | - |
OS089_RS00380 | 52621..52909 | + | 289 | Protein_75 | hypothetical protein | - |
OS089_RS00385 | 52965..53339 | + | 375 | WP_000340977.1 | hypothetical protein | - |
OS089_RS00390 | 53760..54533 | + | 774 | WP_025174055.1 | staphylococcal enterotoxin type P | - |
OS089_RS00395 | 54736..54912 | + | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- | 54900..55074 | - | 175 | - | - | Antitoxin |
OS089_RS00405 | 55124..55378 | + | 255 | WP_000611512.1 | phage holin | - |
OS089_RS00410 | 55390..56145 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
OS089_RS00415 | 56336..56827 | + | 492 | WP_000920038.1 | staphylokinase | - |
OS089_RS00420 | 57478..57813 | + | 336 | Protein_83 | SH3 domain-containing protein | - |
OS089_RS00425 | 58324..58674 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
OS089_RS00430 | 58727..58987 | - | 261 | WP_001791826.1 | hypothetical protein | - |
OS089_RS00435 | 59298..59477 | - | 180 | WP_000669791.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | see / sak / scn | 119..61544 | 61425 | |
- | inside | Prophage | - | see / sak / scn / hysA | 119..71341 | 71222 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T265311 WP_011447039.1 NZ_CP113049:54736-54912 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT265311 NZ_CP113049:c55074-54900 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|