Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 734926..735110 | Replicon | chromosome |
Accession | NZ_CP113047 | ||
Organism | Staphylococcus aureus strain Sett |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | OS087_RS04000 | Protein ID | WP_072467491.1 |
Coordinates | 735003..735110 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 734926..734986 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS087_RS03985 | 730494..730661 | - | 168 | WP_031866196.1 | hypothetical protein | - |
OS087_RS03990 | 730892..732625 | - | 1734 | WP_000486502.1 | ABC transporter ATP-binding protein | - |
OS087_RS03995 | 732650..734413 | - | 1764 | WP_001064834.1 | ABC transporter ATP-binding protein | - |
- | 734926..734986 | + | 61 | - | - | Antitoxin |
OS087_RS04000 | 735003..735110 | - | 108 | WP_072467491.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
OS087_RS04005 | 735244..735630 | - | 387 | WP_000779348.1 | flippase GtxA | - |
OS087_RS04010 | 735887..737029 | + | 1143 | WP_001176873.1 | glycerate kinase | - |
OS087_RS04015 | 737089..737748 | + | 660 | WP_000831298.1 | membrane protein | - |
OS087_RS04020 | 737930..739141 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
OS087_RS04025 | 739264..739737 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3944.67 Da Isoelectric Point: 10.4934
>T265308 WP_072467491.1 NZ_CP113047:c735110-735003 [Staphylococcus aureus]
IFNLLIDIMTSAISGCLVAFFANWLRTRSNKKGDK
IFNLLIDIMTSAISGCLVAFFANWLRTRSNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT265308 NZ_CP113047:734926-734986 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|