Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
Location | 456586..456783 | Replicon | chromosome |
Accession | NZ_CP113047 | ||
Organism | Staphylococcus aureus strain Sett |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | OS087_RS02545 | Protein ID | WP_001802298.1 |
Coordinates | 456679..456783 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 456586..456624 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS087_RS02520 | 452761..453426 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
OS087_RS02525 | 453578..453898 | + | 321 | WP_000003755.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
OS087_RS02530 | 453900..454880 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
OS087_RS02535 | 455146..456237 | + | 1092 | WP_000495681.1 | hypothetical protein | - |
OS087_RS02540 | 456566..456640 | + | 75 | Protein_463 | hypothetical protein | - |
- | 456586..456624 | + | 39 | - | - | Antitoxin |
OS087_RS02545 | 456679..456783 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
OS087_RS02550 | 457463..457621 | + | 159 | WP_001792784.1 | hypothetical protein | - |
OS087_RS02555 | 458279..459136 | - | 858 | WP_000370928.1 | HAD family hydrolase | - |
OS087_RS02560 | 459204..459986 | - | 783 | WP_267830498.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T265306 WP_001802298.1 NZ_CP113047:c456783-456679 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT265306 NZ_CP113047:456586-456624 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|