Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 283860..284167 | Replicon | chromosome |
| Accession | NZ_CP113047 | ||
| Organism | Staphylococcus aureus strain Sett | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | OS087_RS01550 | Protein ID | WP_011447039.1 |
| Coordinates | 283991..284167 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 283860..283999 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS087_RS01510 (279426) | 279426..279605 | + | 180 | WP_000669791.1 | hypothetical protein | - |
| OS087_RS01515 (279916) | 279916..280176 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| OS087_RS01520 (280229) | 280229..280579 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| OS087_RS01525 (281090) | 281090..281425 | - | 336 | Protein_265 | SH3 domain-containing protein | - |
| OS087_RS01530 (282076) | 282076..282567 | - | 492 | WP_267830481.1 | staphylokinase | - |
| OS087_RS01535 (282758) | 282758..283513 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| OS087_RS01540 (283525) | 283525..283779 | - | 255 | WP_000611512.1 | phage holin | - |
| OS087_RS01545 (283831) | 283831..283938 | + | 108 | WP_031866188.1 | hypothetical protein | - |
| - (283860) | 283860..283999 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (283860) | 283860..283999 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (283860) | 283860..283999 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (283860) | 283860..283999 | + | 140 | NuclAT_0 | - | Antitoxin |
| OS087_RS01550 (283991) | 283991..284167 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| OS087_RS01555 (284317) | 284317..284613 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| OS087_RS01560 (284671) | 284671..284958 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| OS087_RS01565 (285005) | 285005..285157 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| OS087_RS01570 (285147) | 285147..288932 | - | 3786 | WP_000582178.1 | phage tail spike protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / sak / hlb / groEL | 280229..332476 | 52247 | |
| - | inside | Prophage | - | map / hlb / scn / sak / hlb / groEL | 276418..335502 | 59084 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T265299 WP_011447039.1 NZ_CP113047:c284167-283991 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT265299 NZ_CP113047:283860-283999 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGATGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGATGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
