Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 138430..138610 | Replicon | chromosome |
Accession | NZ_CP113047 | ||
Organism | Staphylococcus aureus strain Sett |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | OS087_RS00610 | Protein ID | WP_001801861.1 |
Coordinates | 138430..138525 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 138553..138610 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS087_RS00575 | 133471..134097 | + | 627 | WP_000669019.1 | hypothetical protein | - |
OS087_RS00580 | 134138..134479 | + | 342 | WP_049311638.1 | DUF3969 family protein | - |
OS087_RS00585 | 134580..135152 | + | 573 | Protein_116 | hypothetical protein | - |
OS087_RS00590 | 135350..135978 | - | 629 | Protein_117 | ImmA/IrrE family metallo-endopeptidase | - |
OS087_RS00595 | 136278..136454 | - | 177 | WP_000375476.1 | hypothetical protein | - |
OS087_RS00600 | 136465..136848 | - | 384 | WP_000070811.1 | hypothetical protein | - |
OS087_RS00605 | 137533..137979 | - | 447 | WP_000747802.1 | DUF1433 domain-containing protein | - |
OS087_RS00610 | 138430..138525 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 138553..138610 | - | 58 | - | - | Antitoxin |
OS087_RS00615 | 138648..138749 | + | 102 | WP_001791232.1 | hypothetical protein | - |
OS087_RS00620 | 138727..138909 | - | 183 | Protein_123 | transposase | - |
OS087_RS00625 | 139097..139471 | - | 375 | WP_000695818.1 | DUF1433 domain-containing protein | - |
OS087_RS00630 | 139493..139771 | - | 279 | WP_001798632.1 | DUF1433 domain-containing protein | - |
OS087_RS00635 | 140050..140493 | - | 444 | WP_000742594.1 | DUF1433 domain-containing protein | - |
OS087_RS00640 | 141141..142259 | - | 1119 | WP_000072558.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 130911..179879 | 48968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T265297 WP_001801861.1 NZ_CP113047:138430-138525 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT265297 NZ_CP113047:c138610-138553 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|