Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2809308..2809490 | Replicon | chromosome |
Accession | NZ_CP113044 | ||
Organism | Staphylococcus aureus strain LeBlanc |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | OS085_RS13985 | Protein ID | WP_001801861.1 |
Coordinates | 2809308..2809403 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2809431..2809490 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS085_RS13945 | 2804968..2805594 | + | 627 | Protein_2740 | hypothetical protein | - |
OS085_RS13950 | 2805635..2805979 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
OS085_RS13955 | 2806077..2806628 | + | 552 | WP_000414205.1 | hypothetical protein | - |
OS085_RS13960 | 2806846..2807487 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
OS085_RS13965 | 2807601..2807786 | - | 186 | WP_000809857.1 | hypothetical protein | - |
OS085_RS13970 | 2807788..2807964 | - | 177 | WP_000375476.1 | hypothetical protein | - |
OS085_RS13975 | 2807975..2808358 | - | 384 | WP_267836538.1 | hypothetical protein | - |
OS085_RS13980 | 2808962..2809105 | - | 144 | WP_001549059.1 | transposase | - |
OS085_RS13985 | 2809308..2809403 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 2809431..2809490 | - | 60 | - | - | Antitoxin |
OS085_RS13990 | 2809526..2809627 | + | 102 | WP_001791893.1 | hypothetical protein | - |
OS085_RS13995 | 2809605..2809781 | - | 177 | Protein_2750 | transposase | - |
OS085_RS14000 | 2809975..2810352 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2802408..2829406 | 26998 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T265295 WP_001801861.1 NZ_CP113044:2809308-2809403 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT265295 NZ_CP113044:c2809490-2809431 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|