Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprG-sprF/-
Location 267239..267456 Replicon chromosome
Accession NZ_CP113044
Organism Staphylococcus aureus strain LeBlanc

Toxin (Protein)


Gene name SprG3 Uniprot ID Q2FWA7
Locus tag OS085_RS01500 Protein ID WP_001802298.1
Coordinates 267352..267456 (-) Length 35 a.a.

Antitoxin (RNA)


Gene name SprF4
Locus tag -
Coordinates 267239..267294 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS085_RS01475 263376..264041 - 666 WP_001024094.1 SDR family oxidoreductase -
OS085_RS01480 264193..264513 + 321 WP_000003759.1 Zn(II)-responsive metalloregulatory transcriptional repressor CzrA -
OS085_RS01485 264515..265495 + 981 WP_000019744.1 CDF family zinc efflux transporter CzrB -
OS085_RS01490 265761..266852 + 1092 WP_000495671.1 lytic regulatory protein -
- 267239..267294 + 56 - - Antitoxin
OS085_RS01500 267352..267456 - 105 WP_001802298.1 hypothetical protein Toxin
OS085_RS01505 267617..268100 - 484 Protein_290 recombinase family protein -
OS085_RS01510 268143..269279 - 1137 WP_000115564.1 SAP domain-containing protein -
OS085_RS01515 269568..269660 + 93 WP_001790138.1 hypothetical protein -
OS085_RS01520 269949..270133 + 185 Protein_293 exotoxin -
OS085_RS01525 270365..271222 - 858 WP_000370924.1 HAD family hydrolase -
OS085_RS01530 271290..272072 - 783 WP_000908176.1 ABC transporter ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 35 a.a.        Molecular weight: 3906.77 Da        Isoelectric Point: 5.5724

>T265290 WP_001802298.1 NZ_CP113044:c267456-267352 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK

Download         Length: 105 bp

Antitoxin


Download         Length: 56 bp

>AT265290 NZ_CP113044:267239-267294 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y9L9

Antitoxin

Download structure file

References