Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2853050..2853232 | Replicon | chromosome |
Accession | NZ_CP113042 | ||
Organism | Staphylococcus aureus strain Seraphine |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | OS079_RS14320 | Protein ID | WP_001801861.1 |
Coordinates | 2853050..2853145 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2853173..2853232 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS079_RS14280 | 2848710..2849336 | + | 627 | Protein_2807 | hypothetical protein | - |
OS079_RS14285 | 2849377..2849721 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
OS079_RS14290 | 2849819..2850370 | + | 552 | WP_000414205.1 | hypothetical protein | - |
OS079_RS14295 | 2850588..2851229 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
OS079_RS14300 | 2851343..2851528 | - | 186 | WP_000809857.1 | hypothetical protein | - |
OS079_RS14305 | 2851530..2851706 | - | 177 | WP_000375476.1 | hypothetical protein | - |
OS079_RS14310 | 2851717..2852100 | - | 384 | WP_000070811.1 | hypothetical protein | - |
OS079_RS14315 | 2852704..2852847 | - | 144 | WP_001549059.1 | transposase | - |
OS079_RS14320 | 2853050..2853145 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 2853173..2853232 | - | 60 | - | - | Antitoxin |
OS079_RS14325 | 2853268..2853369 | + | 102 | WP_001791893.1 | hypothetical protein | - |
OS079_RS14330 | 2853347..2853523 | - | 177 | Protein_2817 | transposase | - |
OS079_RS14335 | 2853717..2854094 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T265283 WP_001801861.1 NZ_CP113042:2853050-2853145 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT265283 NZ_CP113042:c2853232-2853173 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|