Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 267194..267457 | Replicon | chromosome |
Accession | NZ_CP113042 | ||
Organism | Staphylococcus aureus strain Seraphine |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | OS079_RS01500 | Protein ID | WP_001802298.1 |
Coordinates | 267353..267457 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 267194..267358 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS079_RS01475 | 263377..264042 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
OS079_RS01480 | 264194..264514 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
OS079_RS01485 | 264516..265496 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
OS079_RS01490 | 265762..266853 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 267194..267358 | + | 165 | - | - | Antitoxin |
OS079_RS01500 | 267353..267457 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
OS079_RS01505 | 267618..268101 | - | 484 | Protein_290 | recombinase family protein | - |
OS079_RS01510 | 268144..269280 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
OS079_RS01515 | 269569..269661 | + | 93 | WP_001790138.1 | hypothetical protein | - |
OS079_RS01520 | 269950..270134 | + | 185 | Protein_293 | exotoxin | - |
OS079_RS01525 | 270366..271223 | - | 858 | WP_000370924.1 | HAD family hydrolase | - |
OS079_RS01530 | 271291..272073 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T265277 WP_001802298.1 NZ_CP113042:c267457-267353 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT265277 NZ_CP113042:267194-267358 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|